DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG31269

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:282 Identity:67/282 - (23%)
Similarity:102/282 - (36%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QVCGKSLVQGHFYK------------GLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAA 174
            ::.|.| ..|.|||            |...|    :|..:.::.   |:.|.||:|....:||||
  Fly    22 RIKGNS-TDGRFYKDQRIIGGQAAEDGFAPY----QISLQGISG---AHSCGGAIINETFVLTAA 78

  Fly   175 HCA-------LAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYH 232
            ||.       |....|....:...|.|                     .:..:.:|.:|...:.|
  Fly    79 HCVENAFIPWLVVVTGTNKYNQPGGRY---------------------FLKAIHIHCNYDNPEMH 122

  Fly   233 HDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGK---MSTSSVRQPEMSHLDVPLT 294
            :|||||.|..|:.:...||||.|  ....:..|....:.|||.   ..||.:....:....||..
  Fly   123 NDIALLELVEPIAWDERTQPIPL--PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHR 185

  Fly   295 SWDLCLRNYGSTGALESPNSIEGQWMCAGGE-GKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDN 358
            .....|.|         ....:...:|.... |:..|.|..|.||.  .||..  :|::::|...
  Fly   186 ECKALLSN---------DEDCDVGHICTFSRLGEGACHGDSGGPLV--SNGYL--VGLVNWGWPC 237

  Fly   359 CGGLRIPSVYTSVAHFSEWIHD 380
            ..|  :|.|:.||..:.:||.:
  Fly   238 ATG--VPDVHASVYFYRDWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 60/254 (24%)
Tryp_SPc 138..378 CDD:214473 58/250 (23%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 59/262 (23%)
Tryp_SPc 38..258 CDD:238113 61/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.