DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and sphinx1

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:274 Identity:64/274 - (23%)
Similarity:104/274 - (37%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 EKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADG 183
            |||::..: :..|:..|.......|..:.||. .|.:..|. ||.:|:.:.|||.....      
  Fly    18 EKNKLSPR-IAGGYRAKTFTIIYLVGIVYFKS-QTSSLNYG-AGTIISNQWILTVKTVL------ 73

  Fly   184 HRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTP---LN 245
             :.|.:.|               ..|.|........:.::.:..:..|.:|..:.::|.|   .:
  Fly    74 -KYSYIEV---------------HLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFD 122

  Fly   246 YSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALE 310
            ..:....:....||....||....:.|:|         .|..|..:|  .|..|:.       :|
  Fly   123 RRMDRVRVPAYDTRFERYVGNMTMVCGYG---------TEKRHAKLP--EWMRCIE-------VE 169

  Fly   311 SPNSIEG-------QW--MCAGGEG-KDVCQG-FGGAPLFIQENGIFSQIGIMSFGSDNCGGLRI 364
            ..|:.|.       :|  ||..||| |.||:| .|||.:.:..|..|  |||:....:|| .:..
  Fly   170 VMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTF--IGIIWLMPENC-SIGY 231

  Fly   365 PSVYTSVAHFSEWI 378
            |||:..|:...:||
  Fly   232 PSVHIRVSDHIKWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 59/255 (23%)
Tryp_SPc 138..378 CDD:214473 57/253 (23%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/265 (22%)
Tryp_SPc 26..248 CDD:304450 61/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.