DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and spirit

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:412 Identity:112/412 - (27%)
Similarity:167/412 - (40%) Gaps:99/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYALTILLPILQLFAIVRAESGEFEKLLVPVSHGSAEQRSGARSNETTGHSVAARSYYDVVQNAG 65
            ::.|.:.||:|.:.|...........::.||              ||....    ...||.:..|
  Fly    15 LHLLLVSLPLLAVHATPAISPQSLRGIIFPV--------------ETFDEC----QLEDVARTKG 61

  Fly    66 QTGCSVGTECTPLHDCTALI------YEVARSCYY--GDKSLYCGGSSEELPYVCC-PS-SPL-- 118
                    .|..:.||.:.:      .|..::||:  .|.            |||| |: :|:  
  Fly    62 --------TCRRMEDCPSALNGWLERRESPKTCYFVRFDH------------YVCCAPAVAPIVT 106

  Fly   119 --------EKNQVCGKSLVQGHFYKGLG-------SYPFVARIGFKHVNTGAFAYPCAGAVIARR 168
                    |.|:|.....:...|...:|       .:||:|.:|::........|.|.||:||..
  Fly   107 RSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANN 171

  Fly   169 VILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHH 233
            .:||||||  |...|...|.||:|           ..........:.:|..||:||||.....::
  Fly   172 FVLTAAHC--ADLGGEPPSQVRLG-----------GDNLTLTEGEDISIRRVIIHPDYSASTAYN 223

  Fly   234 DIALLVLKTPLNYSVATQPICL--QKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPL--T 294
            |||||.|:|.....:  :|.|:  ||...|.:|    |..|:|:.|.:.:...::  |.|||  .
  Fly   224 DIALLELETAAKPEL--KPTCIWTQKEVTNTLV----TAIGYGQTSFAGLSSAQL--LKVPLKSV 280

  Fly   295 SWDLCLRNYGSTGALESPNSIEGQWMCAG---GEGKDVCQGFGGAPLFIQENGIFSQIGIMSFGS 356
            |.:.|..:|...   :....:.|..||||   || :|.|||..|.||.:|:..:...:||.|.|.
  Fly   281 SNEECQHHYQKD---QLAQGVLGTQMCAGDITGE-RDTCQGDSGGPLLMQDGLLGYVVGITSLGQ 341

  Fly   357 DNCGGLRIPSVYTSVAHFSEWI 378
            ....|  .|||||.|:.|.:||
  Fly   342 GCASG--PPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 83/255 (33%)
Tryp_SPc 138..378 CDD:214473 81/253 (32%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 13/70 (19%)
Tryp_SPc 132..364 CDD:238113 83/257 (32%)
Tryp_SPc 132..361 CDD:214473 81/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.