DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG11664

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:236 Identity:54/236 - (22%)
Similarity:92/236 - (38%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPD 225
            ||::.:.|.:||.|||.........| |||.|            ..:.|.......::.::.||.
  Fly    48 AGSLFSARYVLTVAHCFKKNTKPEEL-SVRAG------------YRWIAWEFRGKQVAGLLRHPK 99

  Fly   226 YKQGQYHHDIALLVLKTPLNYS-------VATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQ 283
            :......:|||:|.:|..:::|       :.::|:    |..|:....: .:|||..|       
  Fly   100 FSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPL----TPLNMFAPPQ-ELAGWNLM------- 152

  Fly   284 PEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQW--------MCAG---GEGKDVCQGFGGAP 337
                |:..||.|..:.:          .|.....||        :||.   |||  :|.|..|.|
  Fly   153 ----HIAQPLKSMSVQV----------EPEKNCRQWFPQISGGVICASATMGEG--LCYGDSGDP 201

  Fly   338 LFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            |.   :|  .::..::.....||..|.|:::|.|.:...:|
  Fly   202 LI---SG--GEVCGLAIAFRKCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 54/236 (23%)
Tryp_SPc 138..378 CDD:214473 53/234 (23%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/236 (23%)
Tryp_SPc 38..237 CDD:214473 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.