DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG18420

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:83/288 - (28%)
Similarity:126/288 - (43%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSSEELPYVCCPSSPLEKNQ--VCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVI 165
            ||::.|...|...|||:...  |.||..|:       .|.|::|   |.|.::..|.  |.|.:|
  Fly    22 GSTQFLDSECGTRSPLKLGPRIVNGKVAVR-------NSSPWMA---FLHTSSNQFI--CGGTLI 74

  Fly   166 ARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQ 230
            :||::||||||.:.    :....||:|||:...      .|:.....||....|....|:    .
  Fly    75 SRRLVLTAAHCFIP----NTTIVVRLGEYNRKL------KGYREEHQVNRTFQHRFYDPN----T 125

  Fly   231 YHHDIALLVLKTPLNYSVATQPICLQ-----KTRANLVVGKRATIAGWGKMSTSSVR-QPEMSHL 289
            :.:|||||.|.:.:.|....:|||:.     |...:.:  |..|..|||:  |.|:. ..|:..|
  Fly   126 HANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSI--KVLTGTGWGR--TESMHDSSELRTL 186

  Fly   290 DVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAP---LFIQENGI-FSQIG 350
            |:......:|.  :||.        :..|: |||....::|.|..|.|   :....|.. |.|:|
  Fly   187 DISRQPSKMCA--FGSV--------LSNQF-CAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVG 240

  Fly   351 IMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            | :..:..|   :.|||:|.|....|:|
  Fly   241 I-AITNKRC---QRPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 72/251 (29%)
Tryp_SPc 138..378 CDD:214473 71/249 (29%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 75/266 (28%)
Tryp_SPc 43..267 CDD:238113 76/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.