DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG33461

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:283 Identity:85/283 - (30%)
Similarity:129/283 - (45%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LEKNQVCGKSLVQGHFYK-------GLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAH 175
            ||:|  ||  :|....||       .||.||::|   |.|..|   .:.|||::|.:..:||:||
  Fly    28 LEEN--CG--VVPRLSYKIINGTPARLGRYPWMA---FLHTPT---YFLCAGSLINQWFVLTSAH 82

  Fly   176 CALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVL 240
            |.   .|...|.: |:||.:..:|.||.|.. |...:..:.:..:..|..|....:.:||.:|.|
  Fly    83 CI---EDDVELIA-RLGENNRDNDIDCENNR-CLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRL 142

  Fly   241 KTPLNYSVATQPICL-QKTRANLVVGK----RATIAGWG----KMSTSSVRQPEMSHLDVPLTSW 296
            :..:.|:...||||: ...|..|||.:    :||  |||    .::|.|.|         .|...
  Fly   143 ERRVEYTYHIQPICIFHHRRMQLVVDQITWFKAT--GWGLTSTDLNTKSSR---------VLMEL 196

  Fly   297 DLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAP------LFIQENGIFSQIGIMSFG 355
            :|..|.......:...|.:.|| :|||.:..::|:|..|.|      :|..:.  |.|:||.||.
  Fly   197 NLYRRPRNDCARIFKQNFLSGQ-ICAGNDDGNLCRGDSGGPQGRYVLIFGMKR--FVQMGIASFT 258

  Fly   356 SDNCGGLRIPSVYTSVAHFSEWI 378
            .:||..:   |:.|.|..:..||
  Fly   259 YENCSKV---SILTDVVRYGRWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 76/256 (30%)
Tryp_SPc 138..378 CDD:214473 74/254 (29%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 76/264 (29%)
Tryp_SPc 42..281 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.