DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and F9

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:230 Identity:69/230 - (30%)
Similarity:98/230 - (42%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHP 224
            |.||:|..:.|:|||||.   ..|.::..| .||::.....|...         ...:...|.|.
  Rat   253 CGGAIINEKWIVTAAHCL---KPGDKIEVV-AGEHNIDEKEDTEQ---------RRNVIRTIPHH 304

  Fly   225 DYKQ--GQYHHDIALLVLKTPLNYSVATQPICL---QKTRANLVVGKRATIAGWGKMSTSSVRQP 284
            .|..  .:|.||||||.|..||..:....|||:   :.|...|..|. ..::||||:.....:..
  Rat   305 QYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFLKFGS-GYVSGWGKVFNKGRQAS 368

  Fly   285 EMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGE--GKDVCQGFGGAPLFIQENGIFS 347
            .:.:|.|||.....|||:        :..||.....|||..  |||.|:|..|.|...:..|...
  Rat   369 ILQYLRVPLVDRATCLRS--------TKFSIYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTSF 425

  Fly   348 QIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHDNT 382
            ..||:|:| :.|.......:||.|:.:..||.:.|
  Rat   426 LTGIISWG-EECAMKGKYGIYTKVSRYVNWIKEKT 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 68/227 (30%)
Tryp_SPc 138..378 CDD:214473 66/224 (29%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 66/224 (29%)
Tryp_SPc 228..458 CDD:238113 68/227 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.