DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30323

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:232 Identity:38/232 - (16%)
Similarity:75/232 - (32%) Gaps:76/232 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KHVNTGAFAYPCAGAVIARRVILTAAHCALAKADG-----HRLSSVRVGEYDTS--SDPDCANTG 206
            ||:......:.|||::::...::|:..|...:.:.     ....::||..:...  ..|      
  Fly    43 KHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKP------ 101

  Fly   207 FCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIA 271
              :|:::.| :..:::......|  ..::|||    .|:..|..|...:......|.........
  Fly   102 --SPKNIYH-VQKIVLDESAISG--CTELALL----KLDRGVTGQRFAMMLPEKELNSTWLCNSL 157

  Fly   272 GWGKMSTSS---------------------------------VRQPEMSHLDV-PLTSWDLCLRN 302
            |||::...|                                 :|..::|..:. |..|..||:.:
  Fly   158 GWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTS 222

  Fly   303 YGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLF 339
            |...|                    ::||...|:|||
  Fly   223 YTGRG--------------------NMCQQDLGSPLF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 38/232 (16%)
Tryp_SPc 138..378 CDD:214473 38/232 (16%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 36/230 (16%)
Tryp_SPc 45..272 CDD:214473 36/230 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.