DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30286

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:233 Identity:70/233 - (30%)
Similarity:104/233 - (44%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHP 224
            |.|.::..|.|||||||  .:.|.:  .:||:||:::.:..|| |...|.|.|.:..|.....|.
  Fly    60 CGGTLVNHRFILTAAHC--IREDEN--LTVRLGEFNSLTSIDC-NGSDCLPPSEDFEIDVAFRHG 119

  Fly   225 DYKQGQYHHDIALLVLKTPLNYSVATQPICL-QKTRANLVVGK--RATIAGWGKMSTSSVRQPEM 286
            .|.:....|||.||.|...:.|.|..:|||| ..|.....:.:  |....|||: |.|......:
  Fly   120 GYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGR-SPSEAANHIL 183

  Fly   287 SHLDVPLTSWDLCLRNYGSTGALESPNSIEGQW-------MCAGGEGKDVCQGFGGAPL--FIQE 342
            ..:.|...:|.:|.:.|               |       :|...|....|.|..|.|:  .|:.
  Fly   184 KSIRVTRVNWGVCSKTY---------------WVDRRRDQICVSHESGVSCSGDSGGPMGQAIRL 233

  Fly   343 NG--IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            :|  :|.|:||:|:|:..|   ..|||:|:|....:||
  Fly   234 DGRVLFVQVGIVSYGNAEC---LSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 70/233 (30%)
Tryp_SPc 138..378 CDD:214473 68/231 (29%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 70/233 (30%)
Tryp_SPc 39..268 CDD:214473 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.