DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30187

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:123/276 - (44%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 NQVCGKSL---VQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKAD 182
            :|:||.::   :.|.......:..::|.:   |..|   .:.|.|.:|.:|.:||||||.:    
  Fly    25 DQICGINIALKITGGHNAAFQNSVWMAAV---HNRT---HFICGGTLIHKRFVLTAAHCIV---- 79

  Fly   183 GHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYK-QGQYHHDIALLVLKTPLNY 246
            ...:.||.:|.|:.|...|            ...:...:||..:. :..|.:||.||.|.:.:.:
  Fly    80 DQDVQSVSLGAYNKSDPAD------------RKDVITAVVHSSFDVRASYENDIGLLKLSSDVIF 132

  Fly   247 SVATQPIC--LQKTRANLVVGKRATIA-GWGKM---STSSVRQP-EMSHLDVPLTSWDLCLRNYG 304
            :...:|||  |.|:.||.:...|...| |||.:   .||.:.|. .::|||......:|.:  |.
  Fly   133 NALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSV--YP 195

  Fly   305 STGALESPNSIEGQWMCAGGEGKDVCQGFGGAPL----FIQENGIFS---QIGIMSFGSDNCGGL 362
            |          |.| :|||....|.|.|..|.||    |||  ||.:   |.||:|.|..:|.| 
  Fly   196 S----------EKQ-ICAGVPSGDTCGGDSGGPLTNDVFIQ--GIGNREVQFGIISVGKTSCDG- 246

  Fly   363 RIPSVYTSVAHFSEWI 378
              ..|||.:..|::||
  Fly   247 --QGVYTDLMSFADWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 77/256 (30%)
Tryp_SPc 138..378 CDD:214473 75/254 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/264 (29%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.