DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30098

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:106/235 - (45%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 YPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            :.|.|::||.|.:||||||  .|.:.:..  ||:||||:|...|        .::.::.:..:..
  Fly    58 FACGGSLIAYRFVLTAAHC--TKINDNLF--VRLGEYDSSRTTD--------GQTRSYRVVSIYR 110

  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYSVATQPICL-----QKTRANLVVGKRATIAGWGKMSTSSVR 282
            |.:|...: :||||:|.|...:.|....:|||:     .::.||.:  :..|:.|||:|:     
  Fly   111 HKNYIDFR-NHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSI--QNFTLTGWGQMA----- 167

  Fly   283 QPEMSHLDVPLTSWDLCLR----NYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPL-FIQE 342
                .:..:|.|..::.||    .|....:|.         :|.....:..|.|..|.|| .:.:
  Fly   168 ----HYYKMPTTLQEMSLRRVRNEYCGVPSLS---------ICCWNPVQYACFGDSGGPLGSLVK 219

  Fly   343 NG---IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIH 379
            .|   |:.|.|:.:..:.||.|.   |.|..:..:..|::
  Fly   220 YGHKTIYVQFGVTNSVTGNCDGY---SSYLDLMSYMPWLY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 61/235 (26%)
Tryp_SPc 138..378 CDD:214473 60/232 (26%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 60/231 (26%)
Tryp_SPc 37..258 CDD:238113 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.