DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG30090

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:255 Identity:80/255 - (31%)
Similarity:117/255 - (45%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPD 201
            :.|.|::|.|   |.:....   |.|.:|.:|.:||||||.   .:|..: .||:||||.::..|
  Fly    48 INSNPWMAYI---HSSVKLI---CGGTLITQRFVLTAAHCV---NEGSAV-KVRLGEYDDTATED 102

  Fly   202 CANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPIC--LQKTRANLVV 264
            | |:..|.||:..|.:.....|..:.:.:..:|||||.|...:.:.....|||  |..::..||.
  Fly   103 C-NSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVD 166

  Fly   265 GKRATIA-GWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGST------GALESPNSIEGQWMCA 322
            .....:| |||:..|...|..      :.:|.    |:.|.|:      |.|...|.|     ||
  Fly   167 SIEWFVATGWGETRTHRTRGV------LQITQ----LQRYNSSQCMQALGRLVQQNQI-----CA 216

  Fly   323 GGEGKDVCQGFGGAPLFIQENGIFS----QIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            |..|.|.|.|..|.|||.....:..    |.|::|:||..|.|:   .|||.|..:::||
  Fly   217 GRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGI---GVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 80/254 (31%)
Tryp_SPc 138..378 CDD:214473 78/252 (31%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 78/253 (31%)
Tryp_SPc 40..276 CDD:238113 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.