DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and C1s

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:409 Identity:97/409 - (23%)
Similarity:160/409 - (39%) Gaps:117/409 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ETTGHSVAARSYYDVVQNAGQTGCSVGTECTPLHDC--------------------TALIYEVAR 90
            |....:|.:.|:|...|:.||...| ..||.|: ||                    :.:.|....
  Rat   332 EVVEGNVGSTSFYSTCQSNGQWSNS-RLECQPV-DCGVPEPIENGKVEDPEDTVFGSVIHYTCEE 394

  Fly    91 SCYYGDK----SLYCGGSSE--------ELPYVCCPSSPLEKNQVCG--------KSLVQGHFYK 135
            ..||.::    ..:|..:..        ||| .|.|        |||        :..:.|.:..
  Rat   395 PYYYMEQEEGGEYHCAANGSWVNDQLGVELP-KCIP--------VCGVPTEPFKVQQRIFGGYST 450

  Fly   136 GLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKAD-----GHRLSSVRVGEYD 195
            .:.|:|:  ::.|:....|       ||:|....:|||||.....:|     |..|..:.     
  Rat   451 KIQSFPW--QVYFESPRGG-------GALIDEYWVLTAAHVVEGNSDPVMYVGSTLLKIE----- 501

  Fly   196 TSSDPDCANTGFCAPRSVNHAIS-HVIVHPDYKQ-------GQYHHDIALLVLKTPLNYSVATQP 252
                         ..|:....|: .||:||.:||       ..:.:||||:.||.|:.......|
  Rat   502 -------------RLRNAQRLITERVIIHPSWKQEDDLNTRTNFDNDIALVQLKDPVKMGPTVAP 553

  Fly   253 ICLQKTRA--NLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSI 315
            |||.:|.:  |...|....|:|||: :.:.....::....:|:||.:.|     ....:|:|.:.
  Rat   554 ICLPETSSDYNPSEGDLGLISGWGR-TENRTNVIQLRGAKLPITSLEKC-----QQVKVENPKAR 612

  Fly   316 EGQW------MCAGGEGKDVCQG-FGGA---PLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTS 370
            ...:      :|||.:|.|.|:| .|||   |:...::..|...|::|:|. .||..   .:||.
  Rat   613 SNDYVFTDNMICAGEKGVDSCEGDSGGAFALPVPNVKDPKFYVAGLVSWGK-KCGTY---GIYTK 673

  Fly   371 VAHFSEWI----HDNTPPE 385
            |.::.:||    .:|:.|:
  Rat   674 VKNYVDWILKTMQENSGPK 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 69/271 (25%)
Tryp_SPc 138..378 CDD:214473 67/264 (25%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345
CCP 300..361 CDD:153056 9/29 (31%)
CCP 365..428 CDD:153056 8/63 (13%)
Tryp_SPc 443..681 CDD:214473 68/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.