DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and try-10

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:247 Identity:58/247 - (23%)
Similarity:93/247 - (37%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHP 224
            |.|.:||..:::|:|||..:..|....:.|.:|:...:...|    |....||...|||....: 
 Worm   104 CGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDD----GEQEFRSHAMAISKKFFN- 163

  Fly   225 DYKQGQYHHDIALLVLKTPLNYSVATQPICLQ------------KTRANLVVGKRAT----IAGW 273
              ...:.:.|:|::.|  |....|...|:.||            |..|.|...:..|    :|||
 Worm   164 --DASEANDDVAVIFL--PQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGW 224

  Fly   274 GKMS------TSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQG 332
            ||..      :.||||..:          :|.:|..|....|.: .::.|        ....|.|
 Worm   225 GKTENKTAKYSDSVRQMMV----------NLSVRRIGKRKYLIA-KAVTG--------SSRACMG 270

  Fly   333 FGGAPLFIQENGIFSQIG-IMSFGSDNCGGLRIPSVYTSVAH------FSEW 377
            ..|:|::...||....:| :...||.:....:.||.:.|...      .|:|
 Worm   271 DSGSPVYCFVNGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 58/247 (23%)
Tryp_SPc 138..378 CDD:214473 58/247 (23%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.