DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and try-1

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:295 Identity:87/295 - (29%)
Similarity:131/295 - (44%) Gaps:55/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 CG--GSSEELPYVCCPSSPLE----KNQVCGKSLVQGHFYKGLGSYPF----VARIGFKHVNTGA 155
            ||  .::.||........|.:    .:::.|.|....|      |:|:    ::|:|.       
 Worm    30 CGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSPH------SWPWTVQLLSRLGH------- 81

  Fly   156 FAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHV 220
              :.|.|::|....:|||||| .||.......|||||.:         .:|..:|    |.::.|
 Worm    82 --HRCGGSLIDPNFVLTAAHC-FAKDRRPTSYSVRVGGH---------RSGSGSP----HRVTAV 130

  Fly   221 IVHPDYKQG-QYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGK-MSTSSVRQ 283
            .:||.|..| ...:|.|::.:..|:|.|...:||||....|  |..:...:.|||. :..||:..
 Worm   131 SIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLPA--VENRLCVVTGWGSTIEGSSLSA 193

  Fly   284 PEMSHLDVPLTSWDLC--LRNYGSTGALESPNSIEGQWMCAG-GEGK-DVCQGFGGAPLFIQENG 344
            |.:..:.|||.|...|  |.||  .|.:..|:     .:||| ..|| |.|||..|.||....:|
 Worm   194 PTLREIHVPLLSTLFCSSLPNY--IGRIHLPS-----MLCAGYSYGKIDSCQGDSGGPLMCARDG 251

  Fly   345 IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIH 379
            .:...|::|:|. .|....:|.||.:|...|.||:
 Worm   252 HWELTGVVSWGI-GCARPGMPGVYGNVHSASTWIN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 79/252 (31%)
Tryp_SPc 138..378 CDD:214473 77/249 (31%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.