DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and Klk1b5

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:238 Identity:64/238 - (26%)
Similarity:102/238 - (42%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 YPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            |.|.|.::....:||||||...|      ..|.:|:.:...|         .|.:.:..:|..|.
Mouse    48 YQCGGVLLNANWVLTAAHCHNDK------YQVWLGKNNFFED---------EPSAQHRLVSKAIP 97

  Fly   223 HPDYK-----------QGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKM 276
            |||:.           :..|.:|:.||.||.|.:.:...:||.|......|  |.....:|||.:
Mouse    98 HPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKL--GSTCLASGWGSI 160

  Fly   277 STSSVRQP--EMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAG--GEGKDVCQGFGGAP 337
             |..:.:|  ::..::..|...:.|::.:     :|....:   .:|||  ..|||.|.|..|.|
Mouse   161 -TPVIYEPADDLQCVNFKLLPNEDCVKAH-----IEKVTDV---MLCAGDMDGGKDTCMGDSGGP 216

  Fly   338 LFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWIHD 380
            |..  :|:..  ||.|:|...||...:|.:||.:..|:.||.|
Mouse   217 LIC--DGVLH--GITSWGPSPCGKPNVPGIYTKLIKFNSWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 64/238 (27%)
Tryp_SPc 138..378 CDD:214473 61/234 (26%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 61/234 (26%)
Tryp_SPc 25..256 CDD:238113 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.