DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG43336

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:295 Identity:81/295 - (27%)
Similarity:123/295 - (41%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 GSSEELPYVC-----CPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAG 162
            ||::.|...|     .||.|..||....          .|.|.|::|   |.|...|.|.  |.|
  Fly    17 GSTQFLDMACGIRAHSPSVPRVKNGTVA----------SLTSSPWMA---FLHSTDGRFI--CGG 66

  Fly   163 AVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYK 227
            ::|..|::||||||.|.:.:    ...|:||||......| :..:|..| :...:.....|..|.
  Fly    67 SLITNRLVLTAAHCFLDRTE----LVARLGEYDREEYEMC-HDSYCTYR-IEAMVERGFRHRHYN 125

  Fly   228 QGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKR----------ATIAGWGKMSTSSVR 282
            .....:|||:|.|...:.|:...:|||       :|:..|          .|..|||| :.|...
  Fly   126 PMTMAYDIAILRLYRKVQYTDNIRPIC-------IVIDPRWRKYIDSLDPLTGTGWGK-TESEGD 182

  Fly   283 QPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAP----LFIQEN 343
            ..::..:|:.....::| |.|.:.       |:.....|||.|..::|.|..|.|    :...::
  Fly   183 SAKLRTVDLARKHPEVC-RRYATL-------SLTANQFCAGNERSNLCNGDSGGPVGALIPYGKS 239

  Fly   344 GIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            ..|.|:||.||.:..|   .:.||:|.|..:.:||
  Fly   240 KRFVQVGIASFTNTQC---VMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 71/255 (28%)
Tryp_SPc 138..378 CDD:214473 69/253 (27%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 72/273 (26%)
Tryp_SPc 40..271 CDD:238113 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.