DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17572 and CG43124

DIOPT Version :9

Sequence 1:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:230 Identity:50/230 - (21%)
Similarity:87/230 - (37%) Gaps:67/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGE--YDTSSDPDCANTGFCAPRSVNHAISHVIV 222
            ||||:|....:||||.|.   .:..:| :||:|.  :|.|.:              |..::....
  Fly    54 CAGALINNLYVLTAASCF---KENEKL-TVRLGSGYFDKSYE--------------NFRVTKAYF 100

  Fly   223 HPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSV--RQPE 285
            ...:......:::.:..|:|.:.:....:|:|:.|:..:|           |..:|..:  .:|:
  Fly   101 WMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSL-----------GLATTFEIINEKPK 154

  Fly   286 MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMC--AGGEGKDVCQGF-GGAP-LFIQENGIF 346
            |         |..|             .:|:|.: |  ..||.::..|.. .|:| .....||.|
  Fly   155 M---------WYFC-------------KNIKGLF-CKYVFGENEEKWQSKPTGSPWTETISNGPF 196

  Fly   347 S---QIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378
            .   :.||:|: .||   .....||.:|.....||
  Fly   197 KGLVRYGILSY-RDN---KTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 50/230 (22%)
Tryp_SPc 138..378 CDD:214473 48/228 (21%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.