DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10702 and Abl

DIOPT Version :9

Sequence 1:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001261962.1 Gene:Abl / 45821 FlyBaseID:FBgn0000017 Length:1723 Species:Drosophila melanogaster


Alignment Length:185 Identity:36/185 - (19%)
Similarity:61/185 - (32%) Gaps:62/185 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 ELIHRPLLPGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDLQPD-----TRYV 548
            ||:|...:|    ||...|..|          ||:|.......|  :|.|.. :||     ...:
  Fly   342 ELVHHHSVP----HEGHGLITP----------LLYPAPKQNKPT--VFPLSP-EPDEWEICRTDI 389

  Fly   549 VLLRTFGNDEAHEAYEA---------------------RSELTYVQTELDIPKPPLLELV----K 588
            ::....|..:..|.|||                     :..|.......::..|.|::|:    :
  Fly   390 MMKHKLGGGQYGEVYEAVWKRYGNTVAVKTLKEDTMALKDFLEEAAIMKEMKHPNLVQLIGVCTR 454

  Fly   589 KTDSSLTVQMASH---------------DHVSFLLTVFELSDDQDYIEQRNYCHQ 628
            :....:..:..||               |.|:.|....:::....|:|.|||.|:
  Fly   455 EPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMSYLESRNYIHR 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382
AblNP_001261962.1 SH3_Abl 209..263 CDD:212784
SH2_ABL 268..363 CDD:198189 10/34 (29%)
PTKc_Abl 382..644 CDD:270645 20/128 (16%)
Pkinase_Tyr 389..640 CDD:285015 20/121 (17%)
FABD 1584..1723 CDD:197885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.