DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10702 and Shark

DIOPT Version :9

Sequence 1:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster


Alignment Length:175 Identity:41/175 - (23%)
Similarity:61/175 - (34%) Gaps:58/175 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SIDIRNECKNMHLLDNCTVVTGYVMITLITIEQRCNFSEYSYPLLTEITEFMIFTDVRGLVNITE 96
            |||.:.:.|.:|.||  |:|..|        :|..|      .|.|::|          :..|.:
  Fly    71 SIDDKVQTKILHGLD--TLVDYY--------QQAAN------GLPTKLT----------VPLIRD 109

  Fly    97 MFPHLTVIRGRRLFLNYALGVTNMHELEQLVFPKLVAIQRGQVYIGSCPKLCSIGRVNWDL---- 157
            :.||.|...|....|:.|   |:.:| .::||                 :|...|..|:|.    
  Fly   110 LPPHNTRSHGVTNLLHRA---TSKNE-SKVVF-----------------ELLKCGYRNFDAKNQD 153

  Fly   158 ------LTLTRGENNIIMVNKNCSTPVCSGCSSSHCWSNHYCQRS 196
                  |.....:.:|:....|....|.|. .|..|...||..||
  Fly   154 GQTALHLAALHSDEDILKHLLNAKVQVNSS-DSFGCQPLHYAARS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382 23/121 (19%)
Furin-like 171..297 CDD:279142 9/26 (35%)
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210 9/21 (43%)
Ank_2 <112..184 CDD:289560 19/93 (20%)
ANK 117..241 CDD:238125 22/103 (21%)
ANK repeat 124..151 CDD:293786 10/47 (21%)
ANK repeat 153..184 CDD:293786 5/31 (16%)
Ank_2 158..247 CDD:289560 11/41 (27%)
ANK repeat 186..217 CDD:293786 5/12 (42%)
ANK repeat 220..245 CDD:293786
Ank_4 224..274 CDD:290365
SH2_Cterm_shark_like 287..395 CDD:198211
TyrKc 662..921 CDD:197581
PTKc_Syk_like 666..926 CDD:270650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.