DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10702 and Egfr

DIOPT Version :9

Sequence 1:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_476759.1 Gene:Egfr / 37455 FlyBaseID:FBgn0003731 Length:1426 Species:Drosophila melanogaster


Alignment Length:488 Identity:122/488 - (25%)
Similarity:188/488 - (38%) Gaps:134/488 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LYVPCAESKKEH----------ECTSID-------IRNECKNMHLLDNCTVVTGYVMITLITIEQ 64
            |.||   |.|||          .||.:|       :.||..::..|||...||||::|:.:    
  Fly   109 LSVP---SNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHV---- 166

  Fly    65 RCNFSEYSYPLLTEITEFMIFTDVRGLVNITEMFPHLTVIRGRRLFL------NYALGVT--NMH 121
                                  ||:.:|     ||.|.:||||.||.      .|||.||  .|:
  Fly   167 ----------------------DVKKVV-----FPKLQIIRGRTLFSLSVEEEKYALFVTYSKMY 204

  Fly   122 ELEQLVFPKLVAIQRGQVYIGSCPKLCSIGRVNWDLLTLTRGEN-----NIIMVNKNCSTPVCSG 181
            .||   .|.|..:..|||...:...||.:..:.|..: ::.|.:     :.....:.|  |.|..
  Fly   205 TLE---IPDLRDVLNGQVGFHNNYNLCHMRTIQWSEI-VSNGTDAYYNYDFTAPEREC--PKCHE 263

  Fly   182 CSSSHCWSN--HYCQR----SINENVA-----NPKANINACHEECLGGCKNNSSSPADCSVCRGL 235
            ..:..||..  ..||:    :.:...|     .||.. ..||..|.|||  ...:..||..|:..
  Fly   264 SCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPR-ECCHLFCAGGC--TGPTQKDCIACKNF 325

  Fly   236 SDDGVCVKSCPKDK------YVMENYQRCYTKAECVLKHGYVISGSQCVAFCPSGYKTNNRSECV 294
            .|:|||.:.||..:      ||:|      |..|.  |:.|   |:.||..|| |:...:...||
  Fly   326 FDEGVCKEECPPMRKYNPTTYVLE------TNPEG--KYAY---GATCVKECP-GHLLRDNGACV 378

  Fly   295 LCSPDE---------ACISFCTPEWPGKAFTVYNLADAENLRGCQIFNGSLVITIRNKVNETQLY 350
            ...|.:         .|...|....||  .||.:..:.::.|.|.:.:|::.|..:.......:|
  Fly   379 RSCPQDKMDKGGECVPCNGPCPKTCPG--VTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVY 441

  Fly   351 QSFT-----------------SMREVRGHVKVYRS-SQLRSLQFLRNLERVHGDPLENRHYSFIL 397
            .::|                 :::|:.|::.:..: .|.|:|.:.||||.:||..|....::.:.
  Fly   442 ANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALA 506

  Fly   398 YDNKELSELWTPSRQL-EFMEGGMFMHRNNKLC 429
            .....|..|  ..|.| :...|.:.:..|..||
  Fly   507 IVKSSLYSL--EMRNLKQISSGSVVIQHNRDLC 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382 34/119 (29%)
Furin-like 171..297 CDD:279142 40/142 (28%)
FU 210..258 CDD:238021 18/53 (34%)
Recep_L_domain 328..441 CDD:279382 25/121 (21%)
EgfrNP_476759.1 Recep_L_domain 419..547 CDD:279382 25/121 (21%)
GF_recep_IV 572..684 CDD:291509
FU 573..>606 CDD:238021
FU 617..659 CDD:214589
FU 662..716 CDD:214589
FU 739..786 CDD:238021
FU 784..834 CDD:214589
PTKc_EGFR_like 930..1208 CDD:270648
STYKc 938..1194 CDD:214568
Recep_L_domain 128..239 CDD:279382 41/145 (28%)
Furin-like 253..401 CDD:279142 43/164 (26%)
FU 255..292 CDD:214589 8/38 (21%)
FU 302..345 CDD:238021 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.