DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10702 and rol-3

DIOPT Version :9

Sequence 1:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001256097.1 Gene:rol-3 / 179204 WormBaseID:WBGene00004395 Length:2481 Species:Caenorhabditis elegans


Alignment Length:248 Identity:56/248 - (22%)
Similarity:97/248 - (39%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 ILYDN-------KELSELWTPSRQ---LEFMEGG---MFMHRNNKLCNRRMREFQNAVTHDRALD 447
            ||.:|       |||....||.::   ||:||||   .|:.::..      .|:|::....|.|.
 Worm  2020 ILLNNLDHPNIVKELGVCITPGQELILLEYMEGGNLLKFLQKSTP------NEYQSSELSPRDLL 2078

  Fly   448 SLQTNDQEVQCSPLKLQLYVQKRTHRSVKLSWLKSQTS-----QKIEL-IHRPLLPGKLYHEESE 506
            |:..:       ..:...|:::..|....||..|...:     .|:|: :.:.|..|::...:.|
 Worm  2079 SISVD-------IARGMNYLERLPHVHKNLSARKCLLAGRPGVTKLEMGMSKELSNGQVNRSDLE 2136

  Fly   507 LDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDLQPDTRYVVLLR---TFGNDEAHEAYEARSE 568
             :..|   :.|    :.|:.|.:      |..........|.|||.   :|| :..:...:.|..
 Worm  2137 -NMEI---VRW----MAPEVLKD------FQFSSKSDVWAYGVLLYEVFSFG-EVPYGDKDNRRI 2186

  Fly   569 LTYVQTELDIPKP---PLLELVKKTDSSLTVQMASHDHVSFLLTVFE-LSDDQ 617
            :|.|:....:|.|   |...:.|.....||.......:.:.:|.:|| ..|||
 Worm  2187 MTDVRNGSVLPIPSYCPSKRIYKVIKQCLTSDSTKRANFATILKIFETFRDDQ 2239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382 17/57 (30%)
rol-3NP_001256097.1 FN3 1542..1636 CDD:238020
fn3 1664..1749 CDD:278470
STYKc 1966..2232 CDD:214568 51/239 (21%)
PTKc 1970..2233 CDD:270623 51/240 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.800

Return to query results.
Submit another query.