DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and DUS1L

DIOPT Version :9

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_024306636.1 Gene:DUS1L / 64118 HGNCID:30086 Length:572 Species:Homo sapiens


Alignment Length:229 Identity:79/229 - (34%)
Similarity:117/229 - (51%) Gaps:26/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSAPMVRYSKLEFRRLVRLNGVQLAFTPMMISD-SINNSEKARQNEF-STGADDQPLIAQFAAKD 88
            |.||||..|:|.:|.|.|.:|.||.:|||:.:. .:.::...::|.: ....:|:|||.||.|.|
Human    20 VVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANYRKENLYCEVCPEDRPLIVQFCAND 84

  Fly    89 PTEFVTSAQLIYPYVDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQEVRRTLPGDFSVSVK 153
            |..||.:|.|...|.|.||||.||||..|....||..:..:.:|:.:::......|  ...|:.|
Human    85 PEVFVQAALLAQDYCDAIDLNLGCPQMIAKRGHYGAFLQDEWDLLQRMILLAHEKL--SVPVTCK 147

  Fly   154 MRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQK----------HSKDTLDIPAMSQVRQS 208
            :|:.   ..:.:|:..|:.||.||...||:||||..||          |.|         .||::
Human   148 IRVF---PEIDKTVRYAQMLEKAGCQLLTVHGRTKEQKGPLSGAASWEHIK---------AVRKA 200

  Fly   209 LQIPLIVNGNVESYRDACDMHEQTGAAGVMAARG 242
            :.||:..|||::..:|.......||..|||:|.|
Human   201 VAIPVFANGNIQCLQDVERCLRDTGVQGVMSAGG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 79/229 (34%)
Dus 28..321 CDD:279540 78/227 (34%)
DUS1LXP_024306636.1 DUS_like_FMN 18..232 CDD:239200 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D549777at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.