DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and DUS3L

DIOPT Version :9

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_064560.2 Gene:DUS3L / 56931 HGNCID:26920 Length:650 Species:Homo sapiens


Alignment Length:260 Identity:72/260 - (27%)
Similarity:116/260 - (44%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 APMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSE-------KARQNEFSTGADDQPLIAQFA 85
            ||:.....|.|||:.:..|..:....|.:..::...:       |..|.|...|       .|..
Human   310 APLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFG-------VQLE 367

  Fly    86 AKDPTEFVTSAQLI--YPYVDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQEVRRTLPGDF 148
            ...|......|:|:  ...||.:|:|.|||......||.||.::.:.....|:|:.:.:.|  |.
Human   368 GAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVL--DV 430

  Fly   149 SVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSKDTLDIPAMSQVRQSLQ--- 210
            .::||:| .|.:|.:.....|..:|...||..:|||||:..|:::|    :.....:.:.:|   
Human   431 PLTVKIR-TGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTK----LADWQYIEECVQAAS 490

  Fly   211 -IPLIVNGNVESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPLSCVQQWLDIASA 274
             :||..||::.|:.|| :...|||..|:|.|||.|..|.||         |.:...:.| ||:|:
Human   491 PMPLFGNGDILSFEDA-NRAMQTGVTGIMIARGALLKPWLF---------TEIKEQRHW-DISSS 544

  Fly   275  274
            Human   545  544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 66/235 (28%)
Dus 28..321 CDD:279540 72/260 (28%)
DUS3LNP_064560.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..284
DusA 297..576 CDD:223120 72/260 (28%)
DUS_like_FMN 306..538 CDD:239200 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.