DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10495 and Dus3l

DIOPT Version :9

Sequence 1:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001030095.1 Gene:Dus3l / 301122 RGDID:1563228 Length:640 Species:Rattus norvegicus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:128/275 - (46%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 APMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNEFSTGADDQPLIAQFAAKD---- 88
            ||:.....|.|||:.:..|..:....|.:..::      .|.:.|..|    |:.:...:|    
  Rat   300 APLTTCGNLPFRRICKRFGADVTCGEMAMCTNL------LQGQMSEWA----LLKRHPCEDIFGV 354

  Fly    89 ------PTEFVTSAQLIYPY--VDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQEVRRTLP 145
                  |......|:|:...  ||.:|:|.|||......||.||.::.:.....|:|:.:...| 
  Rat   355 QLEGAFPDTMTKCAELLNRTIDVDFVDINVGCPIDLVYKKGGGCALMNRSAKFQQIVRGMNEVL- 418

  Fly   146 GDFSVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSKDTLDIPAMSQ-VRQSL 209
             |..::|||| .|.:|.:.....|..:|.:.||..:|||||:..|:::: ..|.|.:.| .:.:.
  Rat   419 -DVPLTVKMR-TGVQERVSLAHRLLPELRNWGVALVTLHGRSREQRYTR-LADWPYIEQCAKVAS 480

  Fly   210 QIPLIVNGNVESYRDA-CDMHEQTGAAGVMAARGLLANPALFNSNYPDGKTTPLSCVQQWLDIAS 273
            .:||..||::.|:.|| |.|  |||.||:|.|||.|..|.||         |.:...:.| ||:|
  Rat   481 PMPLFGNGDILSFEDANCAM--QTGVAGIMVARGALLKPWLF---------TEIKEQRHW-DISS 533

  Fly   274 AAGDNLLFQCFHHHL 288
            :...::|....|:.|
  Rat   534 SERLDILRDFTHYGL 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 71/236 (30%)
Dus 28..321 CDD:279540 80/275 (29%)
Dus3lNP_001030095.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..106
DusA 287..566 CDD:223120 80/275 (29%)
DUS_like_FMN 296..528 CDD:239200 73/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.