DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LGR5

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_003658.1 Gene:LGR5 / 8549 HGNCID:4504 Length:907 Species:Homo sapiens


Alignment Length:683 Identity:162/683 - (23%)
Similarity:246/683 - (36%) Gaps:202/683 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SKLKVSASHSGPHPLPVEVTAAEEEQAATFGQTSPQKLSLKG-------------------SQLG 59
            |:|.|..|      |||.:      |.||.|.:....:.|:|                   |.||
Human     4 SRLGVLLS------LPVLL------QLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLG 56

  Fly    60 GSILIGNYNYLTQ-LEVCENEMEVL---DLSSLAQLETLKCSRNKLMELIINGT-----NLQTLV 115
            .|.|..|.:..|. |::..|.:..|   .|.||..||.|:.:.|.| ..|..|.     :|:.|:
Human    57 LSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNAL-TYIPKGAFTGLYSLKVLM 120

  Fly   116 ADHNYLHNISTTNTHPV-PLKLQRIDISH----------------------NNFSELPNWVGACA 157
            ..:|.|.::.|.....: .|:..|:|.:|                      |..:|:|  |.|..
Human   121 LQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIP--VQAFR 183

  Fly   158 SLTAINA--------------SHNRLNNVAVL-LRNYRI-----------TELVSLDLAYNDLKQ 196
            ||:|:.|              :...|:::.|| |.|.||           ..|.:|||.||:   
Human   184 SLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNN--- 245

  Fly   197 LDQFPEG---FSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVN 258
            ||:||..   .|:::.|...||.:.|:|:..| |.:..|.|::...|.:..:.|....:...|..
Human   246 LDEFPTAIRTLSNLKELGFHSNNIRSIPEKAF-VGNPSLITIHFYDNPIQFVGRSAFQHLPELRT 309

  Fly   259 LSLAG-NHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPE--- 319
            |:|.| :.:.:  |..|...|.|..|.|...:|..||.......|.|::|.||.|:|:.||.   
Human   310 LTLNGASQITE--FPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSV 372

  Fly   320 -----------------EVATLGQLRVLRCCN-----------NLLLCTPQLAKLAMLKVLDLSH 356
                             :|.|..||..||..|           |.....|.|.|      ||||.
Human   373 CQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIK------LDLSS 431

  Fly   357 NHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIR 421
            |.|....:..|   ..|.:|.|:||..||                 ||  :|..|   .|..|:.
Human   432 NLLSSFPITGL---HGLTHLKLTGNHALQ-----------------SL--ISSEN---FPELKVI 471

  Fly   422 QV---------SAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALE 477
            ::         ....|..|.|..|..|  :.....|..|......:|.:....::.|....|.|:
Human   472 EMPYAYQCCAFGVCENAYKISNQWNKG--DNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLK 534

  Fly   478 GRGRAAQEMSHLV-----PDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAP 537
            .        .|.|     |...|..:.:.|..:.....:|:......|.::.::.:|     |:|
Human   535 A--------LHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVF-----RSP 586

  Fly   538 SKVRPLKSKRYVLRMAS--TG-------GLDAY 561
            ..:.|:|....|:...:  ||       |:||:
Human   587 LYISPIKLLIGVIAAVNMLTGVSSAVLAGVDAF 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/23 (30%)
LRR_8 109..169 CDD:290566 18/101 (18%)
leucine-rich repeat 111..135 CDD:275380 5/24 (21%)
leucine-rich repeat 136..158 CDD:275380 8/43 (19%)
leucine-rich repeat 159..183 CDD:275380 10/49 (20%)
leucine-rich repeat 184..209 CDD:275380 11/27 (41%)
LRR_8 205..266 CDD:290566 16/61 (26%)
leucine-rich repeat 210..230 CDD:275380 7/19 (37%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 50/185 (27%)
leucine-rich repeat 256..276 CDD:275380 6/20 (30%)
LRR_8 279..359 CDD:290566 31/110 (28%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 19/74 (26%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085 21/115 (18%)
LGR5NP_003658.1 LRRNT 33..70 CDD:214470 8/36 (22%)
leucine-rich repeat 68..91 CDD:275380 7/22 (32%)
PLN00113 71..>426 CDD:215061 92/363 (25%)
leucine-rich repeat 92..115 CDD:275380 7/23 (30%)
leucine-rich repeat 116..139 CDD:275380 5/22 (23%)
leucine-rich repeat 140..163 CDD:275380 4/22 (18%)
leucine-rich repeat 164..187 CDD:275380 7/24 (29%)
leucine-rich repeat 188..211 CDD:275380 2/22 (9%)
leucine-rich repeat 212..235 CDD:275380 6/22 (27%)
leucine-rich repeat 236..258 CDD:275380 10/24 (42%)
leucine-rich repeat 259..282 CDD:275380 7/23 (30%)
leucine-rich repeat 283..304 CDD:275380 4/20 (20%)
leucine-rich repeat 307..353 CDD:275378 13/47 (28%)
leucine-rich repeat 354..375 CDD:275378 8/20 (40%)
leucine-rich repeat 376..389 CDD:275378 0/12 (0%)
leucine-rich repeat 400..423 CDD:275378 4/22 (18%)
leucine-rich repeat 445..459 CDD:275378 7/30 (23%)
7tmA_LGR5 558..831 CDD:320485 13/67 (19%)
TM helix 1 559..585 CDD:320485 3/30 (10%)
TM helix 2 592..617 CDD:320485 5/24 (21%)
TM helix 3 637..667 CDD:320485
TM helix 4 679..701 CDD:320485
TM helix 5 721..750 CDD:320485
TM helix 6 759..789 CDD:320485
TM helix 7 799..824 CDD:320485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.