DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT1G65850

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001185325.1 Gene:AT1G65850 / 842896 AraportID:AT1G65850 Length:1051 Species:Arabidopsis thaliana


Alignment Length:314 Identity:83/314 - (26%)
Similarity:123/314 - (39%) Gaps:90/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NYNYLTQLEVCENEMEVLDLSSLAQLETL---KCSRNKLMEL---IINGTNLQTLVADHNYLHNI 124
            |:.||...::.:   |:.|||:...|:.|   |||  .|:||   |...||||.|     || |:
plant   674 NWMYLNHSKILK---ELPDLSTATNLQELFLVKCS--SLVELPSSIGKATNLQKL-----YL-NM 727

  Fly   125 STTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDL 189
            .|                  :..|||:.:|....|..:..  |..:.:.||..|..:..|..|||
plant   728 CT------------------SLVELPSSIGNLHKLQKLTL--NGCSKLEVLPANINLESLDELDL 772

  Fly   190 AYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHA 254
              .|...|.:|||..::|:.|:|....:..:|.:.  .:..||..|.:|         |.||   
plant   773 --TDCLVLKRFPEISTNIKVLKLLRTTIKEVPSSI--KSWPRLRDLELS---------YNQN--- 821

  Fly   255 ALVNLSLAG-NHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSG-NMLQQL 317
                  |.| .|..|.|.....|..:::.:.|...:|.           .|:.|:|:| ..|..|
plant   822 ------LKGFMHALDIITTMYFNDIEMQEIPLWVKKIS-----------RLQTLILNGCKKLVSL 869

  Fly   318 PEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLS-HN---HLDRVNLLAL 367
            |:...:|..|:|:.|              ..|:.||.| ||   .|..:|.|.|
plant   870 PQLPDSLSYLKVVNC--------------ESLERLDCSFHNPKMSLGFINCLKL 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 9/24 (38%)
LRR_8 109..169 CDD:290566 15/59 (25%)
leucine-rich repeat 111..135 CDD:275380 7/23 (30%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 10/24 (42%)
LRR_8 205..266 CDD:290566 13/61 (21%)
leucine-rich repeat 210..230 CDD:275380 3/19 (16%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 29/118 (25%)
leucine-rich repeat 256..276 CDD:275380 5/20 (25%)
LRR_8 279..359 CDD:290566 19/84 (23%)
leucine-rich repeat 280..303 CDD:275380 2/22 (9%)
leucine-rich repeat 304..348 CDD:275380 11/44 (25%)
leucine-rich repeat 349..372 CDD:275380 10/23 (43%)
PP2Cc 461..655 CDD:294085
AT1G65850NP_001185325.1 PLN03210 46..1048 CDD:215633 83/314 (26%)
TIR 48..211 CDD:279864
NK 245..>275 CDD:302627
leucine-rich repeat 599..627 CDD:275380
leucine-rich repeat 628..649 CDD:275380
LRR_3 649..667 CDD:285026
leucine-rich repeat 650..669 CDD:275380
LRR_RI 667..894 CDD:238064 76/297 (26%)
leucine-rich repeat 673..695 CDD:275380 7/23 (30%)
leucine-rich repeat 696..719 CDD:275380 9/24 (38%)
leucine-rich repeat 720..743 CDD:275380 11/46 (24%)
leucine-rich repeat 744..766 CDD:275380 5/23 (22%)
leucine-rich repeat 767..810 CDD:275380 13/46 (28%)
leucine-rich repeat 811..854 CDD:275380 14/71 (20%)
leucine-rich repeat 855..886 CDD:275380 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.