DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RLM1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_176590.2 Gene:RLM1 / 842711 AraportID:AT1G64070 Length:997 Species:Arabidopsis thaliana


Alignment Length:449 Identity:97/449 - (21%)
Similarity:163/449 - (36%) Gaps:145/449 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EVC---ENEME-------VLDLSSLAQLETLKCSRNKLMELIIN------------GTNLQTLVA 116
            |:|   ||::.       :.|.|.:.::..    .||.:..:.|            |.|...:..
plant   513 EICHVLENDIGTGAVSGILFDTSGINEVSI----SNKALRRMCNLRFLSVYKTKHDGYNRMDIPE 573

  Fly   117 DHNY------LHNISTTNTHP---VPLK-----LQRIDISHNNFSELPNWVGACASLTAINASHN 167
            |..:      ||    .:.:|   :|||     |..:|:..:....|  |.|     |.:.....
plant   574 DMEFPPRLRLLH----WDAYPSKCLPLKFRAENLVELDMKDSRLEYL--WPG-----TQLLTKLK 627

  Fly   168 RLNNVAVLLRNYRITELVSLDLAYNDLKQLD--------QFPEGFSSIRSLQL----QSNELPSL 220
            :||    |..:|.:.||..|..|.| |:.||        :.|....::..|.:    ....|..:
plant   628 KLN----LEGSYNLKELPDLSNATN-LEMLDLSVCLALAELPSSIKNLHKLDVIYMDLCESLHMI 687

  Fly   221 PDNFFAVTHARLETLNVS-CNKLSTLPRYEQN------------------NHAA-LVNLSLAGNH 265
            |.|   :..|.|||:.:: |.:|.|.|.:...                  .|.: |:.:.|:|:.
plant   688 PTN---INLASLETMYMTGCPQLKTFPAFSTKIKRLYLVRTGVEEVPASITHCSRLLKIDLSGSR 749

  Fly   266 LNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVL 330
            ...||   .|..:.|:.|.|:...|.::..:|:::             ||:       |..||:.
plant   750 NLKSI---THLPSSLQTLDLSSTDIEMIADSCIKD-------------LQR-------LDHLRLC 791

  Fly   331 RCCNNLLLCTPQL-AKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVC 394
            ||  ..|...|:| |.|.:|...|.  ..|:||......|:..|.:.:.   |:|. :|.|..:.
plant   792 RC--RKLKSLPELPASLRLLTAEDC--ESLERVTYPLNTPTGQLNFTNC---LKLG-EEAQRVII 848

  Fly   395 QSQSQRH----WSLVDVSGNNRAALPTTKI------------------RQVSAQRNQNK 431
            |....:|    .|::....|:||...:.||                  ||:..:|||.:
plant   849 QQSLVKHACFPGSVMPSEFNHRARGNSLKILVKSSASFAFKACVLISPRQLQCERNQRR 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/30 (13%)
LRR_8 109..169 CDD:290566 14/73 (19%)
leucine-rich repeat 111..135 CDD:275380 5/32 (16%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 8/32 (25%)
LRR_8 205..266 CDD:290566 16/84 (19%)
leucine-rich repeat 210..230 CDD:275380 4/23 (17%)
leucine-rich repeat 232..255 CDD:275380 8/41 (20%)
LRR_RI <256..410 CDD:238064 37/158 (23%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 19/80 (24%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 12/44 (27%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085
RLM1NP_176590.2 PLN03210 10..987 CDD:215633 97/449 (22%)
TIR 14..177 CDD:279864
AAA_16 188..324 CDD:289934
leucine-rich repeat 649..672 CDD:275380 4/22 (18%)
leucine-rich repeat 673..695 CDD:275380 4/24 (17%)
leucine-rich repeat 696..716 CDD:275380 7/19 (37%)
leucine-rich repeat 717..739 CDD:275380 1/21 (5%)
leucine-rich repeat 761..784 CDD:275380 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.