DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT1G63750

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001077769.1 Gene:AT1G63750 / 842679 AraportID:AT1G63750 Length:1131 Species:Arabidopsis thaliana


Alignment Length:403 Identity:91/403 - (22%)
Similarity:142/403 - (35%) Gaps:130/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SLAQLETLKC-----SRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHN-N 145
            ||.....|:|     .|..|:|.:..||         .:|.|            |:.:|::.: |
plant   599 SLPPTFNLECLVELNMRESLVEKLWEGT---------QHLKN------------LKYMDLTESKN 642

  Fly   146 FSELPN----------WVGACASLTAINASHNRLNNVAVLLRNYRIT-ELVSLDLAYNDLKQLDQ 199
            ..|||:          ::..|.||..|.:|...|:.:..|..|..|. :::...:....:||::.
plant   643 LKELPDLSNATNLEYFYLDNCESLVEIPSSFAHLHKLEWLEMNNCINLQVIPAHMNLTSVKQVNM 707

  Fly   200 FPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCN-KLSTLPRYEQNNHAALVNLSLAG 263
              :|.|.:|.               |.|....:|.|::|.| :|..:|. ...:...||.|.::.
plant   708 --KGCSRLRK---------------FPVISRHIEALDISDNTELEDMPA-SIASWCHLVYLDMSH 754

  Fly   264 NHLNDSIFEPLHNAAK----LRVLHLAYNRIGVLPAACVRNWPELEILVLSG-NMLQQLPEEVAT 323
            |       |.|....:    ||.|:|:|..|..:| .|::...:||.|.||| ..|..||:...:
plant   755 N-------EKLQGLTQLPTSLRHLNLSYTDIESIP-DCIKALHQLEELCLSGCTRLASLPDLPCS 811

  Fly   324 LGQLRVLRCCNNL-----LLCTPQLAKLAMLKVLDLSHNHLDRV-------NLLALVPSRNLK-- 374
            :..|.. ..|.:|     .|.||. |:|:......|.....:.:       ....|:|.|.:.  
plant   812 IKALEA-EDCESLESVSSPLYTPS-ARLSFTNCFKLGGEAREAIIRRSSDSTGSVLLPGREVPAE 874

  Fly   375 ------------YLDLSGNLQLQVDEQQFKVCQSQSQRH-------------------------W 402
                        .|.|.||       .||.||...|.||                         :
plant   875 FDHRAQGNSLSILLPLGGN-------SQFMVCVVISPRHDITKMSNESELLCRINGESCSYDEEF 932

  Fly   403 SLVDVSGNNRAAL 415
            .:||||...|..|
plant   933 DIVDVSNCRREHL 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/23 (26%)
LRR_8 109..169 CDD:290566 14/70 (20%)
leucine-rich repeat 111..135 CDD:275380 2/23 (9%)
leucine-rich repeat 136..158 CDD:275380 7/32 (22%)
leucine-rich repeat 159..183 CDD:275380 7/24 (29%)
leucine-rich repeat 184..209 CDD:275380 4/24 (17%)
LRR_8 205..266 CDD:290566 14/61 (23%)
leucine-rich repeat 210..230 CDD:275380 2/19 (11%)
leucine-rich repeat 232..255 CDD:275380 6/23 (26%)
LRR_RI <256..410 CDD:238064 50/209 (24%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 26/89 (29%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 17/49 (35%)
leucine-rich repeat 349..372 CDD:275380 3/29 (10%)
PP2Cc 461..655 CDD:294085
AT1G63750NP_001077769.1 PLN03210 6..948 CDD:215633 91/403 (23%)
TIR 18..183 CDD:279864
AAA_16 193..>240 CDD:289934
leucine-rich repeat 559..608 CDD:275380 3/8 (38%)
LRR_RI 577..830 CDD:238064 65/278 (23%)
leucine-rich repeat 609..631 CDD:275380 6/30 (20%)
leucine-rich repeat 632..654 CDD:275380 6/21 (29%)
leucine-rich repeat 655..678 CDD:275380 6/22 (27%)
leucine-rich repeat 679..712 CDD:275380 6/34 (18%)
leucine-rich repeat 713..746 CDD:275380 9/48 (19%)
leucine-rich repeat 768..790 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.