DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT1G63740

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001322890.1 Gene:AT1G63740 / 842678 AraportID:AT1G63740 Length:1063 Species:Arabidopsis thaliana


Alignment Length:309 Identity:70/309 - (22%)
Similarity:114/309 - (36%) Gaps:101/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQKL-SLKGSQLGGSILIGNY--NYLTQLEVCENEMEVL-----DLSSLAQLETLKCSRNKLMEL 104
            |.:| ||......|..|...:  .||.:|.:..|::|.|     .|::|.:||.  |...:|.||
plant   612 PHRLRSLHWEVYPGKSLPSTFRPEYLVELNLQNNKLEKLWEGTQPLTNLNKLEL--CGSLRLKEL 674

  Fly   105 --IINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHN 167
              :.:.||                         |:|:|::            .|.||..|.:|..
plant   675 PDLSSATN-------------------------LKRLDLT------------GCWSLVEIPSSVG 702

  Fly   168 RLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGF--SSIRSLQL----QSNELPSLPDNFF- 225
            .|:.:.              :|..|...||...|..|  :|:|||::    :..:.|.:..|.. 
plant   703 NLHKLE--------------ELEMNLCLQLQVVPTHFNLASLRSLRMLGCWELRKFPGISTNITS 753

  Fly   226 -----AVTHARLETLNV-SCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLH 284
                 |:....||::.: ||  |.||..|              |:.:.       ||...:.::.
plant   754 LVIGDAMLEEMLESIRLWSC--LETLVVY--------------GSVIT-------HNFWAVTLIE 795

  Fly   285 LAYNRIGVLPAACVRNWPELEILVLSG-NMLQQLPEEVATLGQLRVLRC 332
            .....|..:| .|:::.|.|:.|.:.| ..|..|||...:|.:|.|..|
plant   796 KMGTDIERIP-DCIKDLPALKSLYIGGCPKLFSLPELPGSLRRLTVETC 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/20 (30%)
LRR_8 109..169 CDD:290566 10/59 (17%)
leucine-rich repeat 111..135 CDD:275380 0/23 (0%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 7/26 (27%)
LRR_8 205..266 CDD:290566 16/71 (23%)
leucine-rich repeat 210..230 CDD:275380 4/29 (14%)
leucine-rich repeat 232..255 CDD:275380 8/23 (35%)
LRR_RI <256..410 CDD:238064 18/78 (23%)
leucine-rich repeat 256..276 CDD:275380 1/19 (5%)
LRR_8 279..359 CDD:290566 15/55 (27%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 11/30 (37%)
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
AT1G63740NP_001322890.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.