DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT1G56520

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001185252.1 Gene:AT1G56520 / 842105 AraportID:AT1G56520 Length:1117 Species:Arabidopsis thaliana


Alignment Length:343 Identity:86/343 - (25%)
Similarity:143/343 - (41%) Gaps:92/343 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELII----NGTNLQTL 114
            |||.||.|                     ||::.:.:|...|.:..|:..|:|    |||:.:  
plant   527 KGSALGLS---------------------LDVAEIKELVINKKAFKKMCNLLILKVFNGTDPR-- 568

  Fly   115 VADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNY 179
               .:.||         ||.::           |||             :|...|:..|...:::
plant   569 ---DSKLH---------VPEEM-----------ELP-------------SSIRLLHWEAYPRKSF 597

  Fly   180 RI--TELVSLDLAYNDLKQLDQFPEGFSSIRSLQL-QSNELPSLPDNFFAVTHARLETLNVS-CN 240
            |.  ..||:|::.|::|::|.:..:..::::.:.| .|:.|..|||...|   |.||.|:|: ||
plant   598 RFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKA---ANLERLDVAECN 659

  Fly   241 KLSTLPRYEQNNHAALVNLSLAGNHLND----SIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNW 301
            .|..:|....|.| .:|||     |:..    .:...|.|.|.|::       |.:.....::::
plant   660 ALVEIPSSVANLH-KIVNL-----HMESCESLEVIPTLINLASLKI-------INIHDCPRLKSF 711

  Fly   302 PE----LEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRV 362
            |:    ||.||:....:|:||........:..|..|:|..|.|........|:.||||:..::.|
plant   712 PDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWV 776

  Fly   363 NLLALVPSRNLKYLDLSG 380
            . .::....||.||.|||
plant   777 T-DSIKDLHNLYYLKLSG 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/22 (32%)
LRR_8 109..169 CDD:290566 9/59 (15%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 4/25 (16%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 21/62 (34%)
leucine-rich repeat 210..230 CDD:275380 7/20 (35%)
leucine-rich repeat 232..255 CDD:275380 10/23 (43%)
LRR_RI <256..410 CDD:238064 35/133 (26%)
leucine-rich repeat 256..276 CDD:275380 5/23 (22%)
LRR_8 279..359 CDD:290566 20/83 (24%)
leucine-rich repeat 280..303 CDD:275380 2/22 (9%)
leucine-rich repeat 304..348 CDD:275380 12/43 (28%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085
AT1G56520NP_001185252.1 PLN03210 1..950 CDD:215633 86/343 (25%)
TIR 13..176 CDD:279864
AAA_16 187..322 CDD:289934
LRR_3 603..622 CDD:285026 6/18 (33%)
leucine-rich repeat 604..626 CDD:275380 6/21 (29%)
leucine-rich repeat 627..649 CDD:275380 7/24 (29%)
leucine-rich repeat 650..673 CDD:275380 10/23 (43%)
leucine-rich repeat 674..696 CDD:275380 6/26 (23%)
leucine-rich repeat 697..717 CDD:275380 3/26 (12%)
leucine-rich repeat 718..740 CDD:275380 7/21 (33%)
leucine-rich repeat 741..762 CDD:275380 5/20 (25%)
leucine-rich repeat 763..785 CDD:275380 6/22 (27%)
leucine-rich repeat 786..807 CDD:275380 6/8 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.