DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RPP27

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_175849.2 Gene:RPP27 / 841889 AraportID:AT1G54470 Length:457 Species:Arabidopsis thaliana


Alignment Length:386 Identity:97/386 - (25%)
Similarity:146/386 - (37%) Gaps:120/386 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KATRKQADPYKSKLKVSASHSGPHPLPVEVTAAEEEQAATFGQ--------TSPQKLSLK-GSQL 58
            :.:.|:::..:.||.::|..:|    .:...||....|...|.        |...:|.|| |.:.
plant    45 RTSLKESNSVELKLSLAAIVAG----VLYFLAALISSACGIGSGGLFIPITTLVSRLDLKTGKRF 105

  Fly    59 GGSILIGNYNYLTQLEVCENEME-----VLDL-------------------------SSLAQLET 93
            .|..||.....|.||..|::.:|     :||.                         |...|.|:
plant   106 LGQYLIWVILLLGQLHECKSCIEKERVALLDFKKYWMSITQESDLDYVFPTWNNDTKSDCCQWES 170

  Fly    94 LKC--SRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPV------------------------ 132
            :.|  :..:|:.|.:..:||:     .|.|.|||.  .||.                        
plant   171 IMCNPTSGRLIRLHVGASNLK-----ENSLLNISL--LHPFEEVRSLELSAGLNGFVDNVEGYKS 228

  Fly   133 --PLK-LQRIDISHNN-FSE--LPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAY 191
              .|| |:.:|:|:|| |:.  || ::.|..|||:::..:|.:...........:|.|..|||:.
plant   229 LRKLKNLEILDLSYNNRFNNNILP-FINAATSLTSLSLQNNSMEGPFPFEEIKDLTNLKLLDLSR 292

  Fly   192 N-------------DLKQLDQFPEGFSSIRSLQLQSN-----ELPSLPDNFFAVTHA-------R 231
            |             .||.||.....||||..||:...     || .|.:|.|.....       :
plant   293 NILKGPMQGLTHLKKLKALDLSNNVFSSIMELQVVCEMKNLWEL-DLRENKFVGQLPLCLGRLNK 356

  Fly   232 LETLNVSCNKL-----STLPRYEQNNHAALVNLSLAGNHLNDSI-FEPLHNAAKLRVLHLA 286
            |..|::|.|:|     ||..|.|     :|..|||..|:..... |:||.|..||:|..|:
plant   357 LRVLDLSSNQLNGNLPSTFNRLE-----SLEYLSLLDNNFTGFFSFDPLANLTKLKVFKLS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/20 (20%)
LRR_8 109..169 CDD:290566 24/89 (27%)
leucine-rich repeat 111..135 CDD:275380 8/49 (16%)
leucine-rich repeat 136..158 CDD:275380 9/24 (38%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 13/37 (35%)
LRR_8 205..266 CDD:290566 24/77 (31%)
leucine-rich repeat 210..230 CDD:275380 7/24 (29%)
leucine-rich repeat 232..255 CDD:275380 9/27 (33%)
LRR_RI <256..410 CDD:238064 13/32 (41%)
leucine-rich repeat 256..276 CDD:275380 8/20 (40%)
LRR_8 279..359 CDD:290566 4/8 (50%)
leucine-rich repeat 280..303 CDD:275380 3/7 (43%)
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
RPP27NP_175849.2 LRRNT_2 130..174 CDD:285463 5/43 (12%)
LRR_RI <211..367 CDD:238064 40/157 (25%)
leucine-rich repeat 235..259 CDD:275380 9/24 (38%)
LRR_8 258..316 CDD:290566 14/57 (25%)
leucine-rich repeat 260..284 CDD:275380 3/23 (13%)
LRR_8 283..367 CDD:290566 25/84 (30%)
leucine-rich repeat 285..307 CDD:275380 5/21 (24%)
leucine-rich repeat 308..332 CDD:275380 10/23 (43%)
leucine-rich repeat 333..356 CDD:275380 5/23 (22%)
leucine-rich repeat 357..380 CDD:275380 9/27 (33%)
leucine-rich repeat 381..405 CDD:275380 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.