DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT1G17600

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_173203.2 Gene:AT1G17600 / 838336 AraportID:AT1G17600 Length:1049 Species:Arabidopsis thaliana


Alignment Length:488 Identity:102/488 - (20%)
Similarity:160/488 - (32%) Gaps:154/488 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGPHPLPVEVTAAEEEQAATFGQTSPQKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSS 87
            ||..|..:...........|....:|...|||...:.||      .:|.||.         ||||
plant   598 SGSDPCFLVELNLRHSDLETLWSGTPMLKSLKRLDVTGS------KHLKQLP---------DLSS 647

  Fly    88 LAQLETL---KCSR-NKLMELIINGTNLQTLVADH------------------------------ 118
            :..||.|   :|:| ..:.|.|...:.|:.|...:                              
plant   648 ITSLEELLLEQCTRLEGIPECIGKRSTLKKLKLSYRGGRRSALRFFLRKSTRQQHIGLEFPDAKV 712

  Fly   119 -----------------------NYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLT 160
                                   .|...:|..:...:|:      ||..:..:.|..:..|    
plant   713 KMDALINISIGGDITFEFRSKFRGYAEYVSFNSEQQIPI------ISAMSLQQAPWVISEC---- 767

  Fly   161 AINASHNRLNNVAVLLRNYRIT-ELVSLDL--AYNDLKQLD-------QFPEG---FSSIRSLQL 212
                  ||.|::.::..:::.. |..|.|:  .:.|||:|.       :.|.|   ...:..|.|
plant   768 ------NRFNSLRIMRFSHKENGESFSFDVFPDFPDLKELKLVNLNIRKIPSGICHLDLLEKLDL 826

  Fly   213 QSNELPSLPDNFFAVTHARLETLNV-SCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHN 276
            ..|:..:||:...::  :||:||.: :|.||..||:..|.....|.|.            ..|.:
plant   827 SGNDFENLPEAMSSL--SRLKTLWLQNCFKLQELPKLTQVQTLTLTNC------------RNLRS 877

  Fly   277 AAKLRVLHLAYNRIGVLPAACVRN-------------WPELEILVLSGNMLQQLPEEVATLGQLR 328
            .|||........|..:| ..|:.|             :.:|..|.||.:..:.||..:..|..| 
plant   878 LAKLSNTSQDEGRYCLL-ELCLENCKSVESLSDQLSHFTKLTCLDLSNHDFETLPSSIRDLTSL- 940

  Fly   329 VLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDL------SGNLQLQVD 387
            |..|.||   |    .||..::.|.||...||.....:|.......:.|:      :.|...|..
plant   941 VTLCLNN---C----KKLKSVEKLPLSLQFLDAHGCDSLEAGSAEHFEDIPNKEAHTRNDYFQET 998

  Fly   388 EQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKI 420
            |....|.::|:.|          ||..:...||
plant   999 EMSSYVLKTQATR----------NRQTIRLPKI 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/22 (32%)
LRR_8 109..169 CDD:290566 10/112 (9%)
leucine-rich repeat 111..135 CDD:275380 5/76 (7%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 3/24 (13%)
leucine-rich repeat 184..209 CDD:275380 8/36 (22%)
LRR_8 205..266 CDD:290566 17/61 (28%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 9/23 (39%)
LRR_RI <256..410 CDD:238064 38/172 (22%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 24/92 (26%)
leucine-rich repeat 280..303 CDD:275380 5/35 (14%)
leucine-rich repeat 304..348 CDD:275380 15/43 (35%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085
AT1G17600NP_173203.2 PLN03210 1..>976 CDD:215633 91/431 (21%)
leucine-rich repeat 798..820 CDD:275380 5/21 (24%)
leucine-rich repeat 821..843 CDD:275380 5/23 (22%)
leucine-rich repeat 844..863 CDD:275380 8/18 (44%)
leucine-rich repeat 895..916 CDD:275380 2/20 (10%)
leucine-rich repeat 917..939 CDD:275380 7/21 (33%)
leucine-rich repeat 940..960 CDD:275380 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.