DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ERL1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_201029.1 Gene:ERL1 / 836344 AraportID:AT5G62230 Length:966 Species:Arabidopsis thaliana


Alignment Length:479 Identity:121/479 - (25%)
Similarity:182/479 - (37%) Gaps:135/479 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQTSP--------QKLSLKGSQLGGSI--LIGNYNYLTQLEVCENEME---VLDLSSLAQLETLK 95
            |:.||        |.:.|:|::|.|.|  .|||...|..|::.||.:.   ...:|.|.|||||.
plant    85 GEISPAIGDLRNLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLN 149

  Fly    96 CSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPL------KLQRIDISHNN----FSELP 150
            ...|:|                           |.|||.      .|:|:|::.|:    .|.|.
plant   150 LKNNQL---------------------------TGPVPATLTQIPNLKRLDLAGNHLTGEISRLL 187

  Fly   151 NW--------------VGACAS----LTAINASHNRLNNVAVLLRNY--RITELVSLDLAYNDLK 195
            .|              .|..:|    ||.:.....|.||:...:...  ..|....||::||.:.
plant   188 YWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQIT 252

  Fly   196 QLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKL-STLPRYEQNNHAALVNL 259
            ....:..||..:.:|.||.|.|.........:..| |..|::|.|:| ..:|       ..|.||
plant   253 GEIPYNIGFLQVATLSLQGNRLTGRIPEVIGLMQA-LAVLDLSDNELVGPIP-------PILGNL 309

  Fly   260 S------LAGNHLNDSIFEPLHNAAKLRVLHLAYNR-IGVLPAACVRNWPEL-------EILVLS 310
            |      |.||.|...|...|.|.::|..|.|..|: :|.:|       |||       |:.:.:
plant   310 SFTGKLYLHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIP-------PELGKLEQLFELNLAN 367

  Fly   311 GNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLA--KLAMLKVLDLSHNHLDRVNLLALVPSR-- 371
            ..::..:|..:::...|.......|||..:..||  .|..|..|:||.|     |....:|..  
plant   368 NRLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSN-----NFKGKIPVELG 427

  Fly   372 ---NLKYLDLSGN-----LQLQVDEQQFKVCQSQSQRHWS--------------LVDVSGNNRAA 414
               ||..||||||     :.|.:.:.:..:..:.|:.|.|              ::|||.|..:.
plant   428 HIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSG 492

  Fly   415 LPTTKIRQV----SAQRNQNKTSG 434
            :..|::.|:    |...|.||..|
plant   493 VIPTELGQLQNLNSLILNNNKLHG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/18 (33%)
LRR_8 109..169 CDD:290566 15/87 (17%)
leucine-rich repeat 111..135 CDD:275380 4/29 (14%)
leucine-rich repeat 136..158 CDD:275380 8/39 (21%)
leucine-rich repeat 159..183 CDD:275380 5/25 (20%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 19/67 (28%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 6/23 (26%)
LRR_RI <256..410 CDD:238064 51/193 (26%)
leucine-rich repeat 256..276 CDD:275380 10/25 (40%)
LRR_8 279..359 CDD:290566 23/89 (26%)
leucine-rich repeat 280..303 CDD:275380 6/23 (26%)
leucine-rich repeat 304..348 CDD:275380 10/52 (19%)
leucine-rich repeat 349..372 CDD:275380 7/27 (26%)
PP2Cc 461..655 CDD:294085
ERL1NP_201029.1 PLN00113 12..916 CDD:215061 121/479 (25%)
leucine-rich repeat 73..96 CDD:275380 3/10 (30%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
leucine-rich repeat 121..144 CDD:275380 6/22 (27%)
leucine-rich repeat 145..168 CDD:275380 10/49 (20%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..216 CDD:275380 3/22 (14%)
leucine-rich repeat 217..240 CDD:275380 3/22 (14%)
leucine-rich repeat 241..263 CDD:275380 6/21 (29%)
leucine-rich repeat 266..287 CDD:275380 5/20 (25%)
leucine-rich repeat 288..311 CDD:275380 9/29 (31%)
leucine-rich repeat 312..335 CDD:275380 7/22 (32%)
leucine-rich repeat 336..359 CDD:275380 9/29 (31%)
leucine-rich repeat 360..383 CDD:275380 2/22 (9%)
leucine-rich repeat 384..407 CDD:275380 7/22 (32%)
leucine-rich repeat 408..431 CDD:275380 7/27 (26%)
leucine-rich repeat 432..455 CDD:275380 8/22 (36%)
leucine-rich repeat 456..479 CDD:275380 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.