DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G46520

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001330914.1 Gene:AT5G46520 / 834695 AraportID:AT5G46520 Length:1206 Species:Arabidopsis thaliana


Alignment Length:368 Identity:86/368 - (23%)
Similarity:134/368 - (36%) Gaps:111/368 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LSSLAQLETLKCSRNKLMELIINGTNLQTL-VADHNYLHNI----STTNTHPVPLKLQRIDISHN 144
            |.:|.:||.......||.|..::.|.|:.| :....||..|    ..||       ::::|..| 
plant   644 LRNLVKLEMHDSKLEKLWEGAMSFTCLKELDMWASKYLKEIPDLSKATN-------IEKLDFGH- 700

  Fly   145 NFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLD----------- 198
                       |.||..:.:|...||.:..|...| ..||.:|...:| ||.||           
plant   701 -----------CWSLVELPSSIRNLNKLLELNMEY-CGELETLPTGFN-LKSLDYLNFNECWKLR 752

  Fly   199 QFPEGFSSIRSLQLQSNELPSLPDNFF-----AVTHARLETLNVSCNKLS--------TLPRYEQ 250
            .|||..::|.:|.|....:...|.|.:     .::..:.::....|..:.        ||...|.
plant   753 TFPEFATNISNLILAETSIEEYPSNLYFKNVRELSMGKADSDENKCQGVKPFMPMLSPTLTLLEL 817

  Fly   251 NNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQ 315
            .|...||.||        |.|:.|:|..:|.:.:            | ||   ||.|....|:  
plant   818 WNIPNLVELS--------SSFQNLNNLERLDICY------------C-RN---LESLPTGINL-- 856

  Fly   316 QLPEEVATLGQLRVLRCCNNLLLCT-----PQLAKLAMLKVLDLSHNHLDRV--------NL--L 365
               |.:.:|          ||..|:     |.::  ..:|.|||....::.|        ||  |
plant   857 ---ESLVSL----------NLFGCSRLKRFPDIS--TNIKYLDLDQTGIEEVPWQIENFFNLTKL 906

  Fly   366 ALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVS 408
            .:...|.||.:.|:......:.|..|..|.:.::     ||:|
plant   907 TMKGCRELKCVSLNIFKLKHLGEVSFSNCGALTR-----VDLS 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/18 (28%)
LRR_8 109..169 CDD:290566 14/64 (22%)
leucine-rich repeat 111..135 CDD:275380 7/28 (25%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 11/35 (31%)
LRR_8 205..266 CDD:290566 14/73 (19%)
leucine-rich repeat 210..230 CDD:275380 4/24 (17%)
leucine-rich repeat 232..255 CDD:275380 5/30 (17%)
LRR_RI <256..410 CDD:238064 40/168 (24%)
leucine-rich repeat 256..276 CDD:275380 7/19 (37%)
LRR_8 279..359 CDD:290566 18/84 (21%)
leucine-rich repeat 280..303 CDD:275380 4/22 (18%)
leucine-rich repeat 304..348 CDD:275380 10/48 (21%)
leucine-rich repeat 349..372 CDD:275380 8/32 (25%)
PP2Cc 461..655 CDD:294085
AT5G46520NP_001330914.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.