DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G46450

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_199457.1 Gene:AT5G46450 / 834688 AraportID:AT5G46450 Length:1123 Species:Arabidopsis thaliana


Alignment Length:363 Identity:75/363 - (20%)
Similarity:138/363 - (38%) Gaps:109/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPL 134
            |.:|::||:::|                  ||.:.:.:.|.|:.:  |.....|:.......:..
plant   607 LVKLQMCESKLE------------------KLWDGVHSLTGLRNM--DLRGSENLKEIPDLSLAT 651

  Fly   135 KLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVL-------LRNYRITELVSLDLAY- 191
            .|:::|:|:            |.||..::::...||.:..|       |.|..|.  ::|:..| 
plant   652 NLKKLDVSN------------CTSLVELSSTIQNLNQLEELQMERCENLENLPIG--INLESLYC 702

  Fly   192 ---NDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNH 253
               |...:|..||:..::|..|.|....:...|      |...||.|..       |..|:..:.
plant   703 LNLNGCSKLRSFPDISTTISELYLSETAIEEFP------TELHLENLYY-------LGLYDMKSE 754

  Fly   254 ------------AALVNLSLAGNHLND--------SIFEPLHNAAKLRVLHLAYNRIGVLP---- 294
                        ..:::.||....|:|        |.|:.|||...|.:...  ..:..||    
plant   755 KLWKRVQPLTPLMTMLSPSLTKLFLSDIPSLVELPSSFQNLHNLEHLNIARC--TNLETLPTGVN 817

  Fly   295 ---------AAC--VRNWPELEI----LVLSGNMLQQLP---EEVATLGQLRVLRCCNNLLLCTP 341
                     :.|  :|::|::..    |||.|..::::|   |:...|..|.::. ||||...:.
plant   818 LELLEQLDFSGCSRLRSFPDISTNIFSLVLDGTGIEEVPWWIEDFYRLSFLSMIG-CNNLQGVSL 881

  Fly   342 QLAKLAMLKVLD------LSHNHLDRVNLLALVPSRNL 373
            .::||..|:.:|      |||.:.|.:.....:.:.|:
plant   882 NISKLEKLETVDFSDCEALSHANWDTIPSAVAMATENI 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 2/18 (11%)
LRR_8 109..169 CDD:290566 10/59 (17%)
leucine-rich repeat 111..135 CDD:275380 3/23 (13%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 7/30 (23%)
leucine-rich repeat 184..209 CDD:275380 7/28 (25%)
LRR_8 205..266 CDD:290566 12/72 (17%)
leucine-rich repeat 210..230 CDD:275380 4/19 (21%)
leucine-rich repeat 232..255 CDD:275380 5/34 (15%)
LRR_RI <256..410 CDD:238064 36/154 (23%)
leucine-rich repeat 256..276 CDD:275380 7/27 (26%)
LRR_8 279..359 CDD:290566 25/107 (23%)
leucine-rich repeat 280..303 CDD:275380 5/37 (14%)
leucine-rich repeat 304..348 CDD:275380 14/50 (28%)
leucine-rich repeat 349..372 CDD:275380 6/28 (21%)
PP2Cc 461..655 CDD:294085
AT5G46450NP_199457.1 PLN03210 1..1123 CDD:215633 75/363 (21%)
TIR 13..178 CDD:279864
AAA_16 185..>234 CDD:289934
NK 212..>242 CDD:302627
leucine-rich repeat 557..584 CDD:275380
leucine-rich repeat 585..606 CDD:275380
LRR_3 606..624 CDD:285026 7/34 (21%)
leucine-rich repeat 607..629 CDD:275380 7/39 (18%)
AMN1 <626..714 CDD:187754 20/103 (19%)
leucine-rich repeat 630..652 CDD:275380 3/23 (13%)
leucine-rich repeat 653..676 CDD:275380 7/34 (21%)
leucine-rich repeat 677..699 CDD:275380 5/23 (22%)
leucine-rich repeat 700..720 CDD:275380 5/19 (26%)
leucine-rich repeat 721..742 CDD:275380 6/26 (23%)
leucine-rich repeat 743..773 CDD:275380 3/36 (8%)
leucine-rich repeat 774..797 CDD:275380 6/22 (27%)
leucine-rich repeat 798..820 CDD:275380 3/23 (13%)
leucine-rich repeat 842..867 CDD:275380 7/24 (29%)
leucine-rich repeat 868..888 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.