DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G41550

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_198970.1 Gene:AT5G41550 / 834157 AraportID:AT5G41550 Length:1085 Species:Arabidopsis thaliana


Alignment Length:381 Identity:77/381 - (20%)
Similarity:145/381 - (38%) Gaps:105/381 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KQAD-PYKSKLKVSASHSGPHPLPVEVTAAEEEQAAT------------FGQTSPQKLSLKGSQL 58
            :|:| |.|.:..:.|.         |:.|...::..|            .|:.|..|.:.:|.:.
plant   501 EQSDEPGKRQFLIEAE---------EIRAVLTDETGTGSVIGISYNTSNIGEVSVSKGAFEGMRN 556

  Fly    59 GGSILIGNYNYLTQ--LEVCENEMEVLDLSSLAQLETLKCSR------------NKLMELIINGT 109
            ...:.|.||.:..:  |::.|      |:..|..|..|...|            .:|:||.:..:
plant   557 LRFLRIFNYLFSGKCTLQIPE------DMEYLPPLRLLHWDRYPRKSLPTKFQPERLLELHMPHS 615

  Fly   110 NLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHN-NFSELPNWVGA----------CASLTAIN 163
            ||:.|..           ...|:| .::.||:|.: ...|:||...|          |.:|..:.
plant   616 NLEKLWG-----------GIQPLP-NIKSIDLSFSIRLKEIPNLSNATNLETLNLTHCKTLVELP 668

  Fly   164 ASHNRLNNVAVL----LRNYRI----TELVSLDLA-YNDLKQLDQFPEGFSSIRSLQLQSNELPS 219
            :|.:.|:.:..|    ....|:    ..|.||::. .|...:|.:||:..|:|::|.:.:.::.:
plant   669 SSISNLHKLKKLKMSGCEKLRVIPTNINLASLEVVRMNYCSRLRRFPDISSNIKTLSVGNTKIEN 733

  Fly   220 LPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLH 284
            .|.: .|.:.:||..|.:....|..|....|    ::::|:|:.:.:                  
plant   734 FPPS-VAGSWSRLARLEIGSRSLKILTHAPQ----SIISLNLSNSDI------------------ 775

  Fly   285 LAYNRIGVLPAACVRNWPEL-EILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLC 339
               .||    ..||.:.|.| |::|.:...|..:|.....|..|...:|.:...:|
plant   776 ---RRI----PDCVISLPYLVELIVENCRKLVTIPALPPWLESLNANKCASLKRVC 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/30 (20%)
LRR_8 109..169 CDD:290566 15/70 (21%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 8/32 (25%)
leucine-rich repeat 159..183 CDD:275380 5/31 (16%)
leucine-rich repeat 184..209 CDD:275380 9/25 (36%)
LRR_8 205..266 CDD:290566 13/60 (22%)
leucine-rich repeat 210..230 CDD:275380 3/19 (16%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 16/85 (19%)
leucine-rich repeat 256..276 CDD:275380 2/19 (11%)
LRR_8 279..359 CDD:290566 14/62 (23%)
leucine-rich repeat 280..303 CDD:275380 4/22 (18%)
leucine-rich repeat 304..348 CDD:275380 9/37 (24%)
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
AT5G41550NP_198970.1 TIR 13..175 CDD:279864
NB-ARC 189..443 CDD:279299
AAA 212..327 CDD:99707
leucine-rich repeat 557..584 CDD:275380 7/32 (22%)
leucine-rich repeat 585..606 CDD:275380 3/20 (15%)
leucine-rich repeat 607..629 CDD:275380 8/33 (24%)
LRR_3 607..625 CDD:285026 6/28 (21%)
LRR <628..787 CDD:227223 38/189 (20%)
leucine-rich repeat 630..652 CDD:275380 7/21 (33%)
leucine-rich repeat 653..676 CDD:275380 4/22 (18%)
leucine-rich repeat 677..699 CDD:275380 3/21 (14%)
leucine-rich repeat 700..720 CDD:275380 5/19 (26%)
leucine-rich repeat 721..744 CDD:275380 4/23 (17%)
leucine-rich repeat 765..787 CDD:275380 6/46 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.