DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G40100

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_198826.1 Gene:AT5G40100 / 834007 AraportID:AT5G40100 Length:1017 Species:Arabidopsis thaliana


Alignment Length:468 Identity:105/468 - (22%)
Similarity:175/468 - (37%) Gaps:149/468 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KLSLKGSQL----GGSILIGNYNYLTQLEV--CENEMEVLDLSSLAQLETL---KCSRNK-LMEL 104
            :|:|:.|.|    .|.:..|   :|.:|:|  .:|..::.|||...:|:.|   :|.|.| :.|.
plant   600 ELNLRHSNLETLWSGVLKFG---HLRKLDVTGSKNLKQLPDLSCAEELDELLLEQCKRLKGIPES 661

  Fly   105 IINGTNLQTLVADHN---------YLHNISTTN-------THPVPLKLQRIDIS----------- 142
            |...:.|..|...:.         .:..:|.|.       |..|.::|..|.|:           
plant   662 IAERSTLGRLNLSYYGGAKNPMGVVIQKVSQTQRITLLFPTSSVEMQLMNISITGDIRFRVFADF 726

  Fly   143 -----HNNFS--------------ELPNWVGACASLTAINASH--NRLNNVAVLLRNY-RITELV 185
                 :.:||              :.|..:......|.:|...  .:.|...|.|.:: .|..|.
plant   727 EGYAEYFSFSTEQKIHATRTVSVHQAPRLISELNKSTTLNIRRFSYKENGRPVTLHSFPDIPGLK 791

  Fly   186 SLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNV-SCNKLSTLPRYE 249
            .|:|...::::|......|..:.:|.|..|:..:||::...:  :||:||.: :|:||..||...
plant   792 QLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENLPEDMNRL--SRLKTLCLRNCSKLKELPELT 854

  Fly   250 Q---------NNHAALVNLSLAGNHLNDSIFEPLH----NAAKLRVLHLAYNRIGVLPAACVRNW 301
            |         .|..:||.:|.|..  :.|::..|.    |...::.|           :..:.::
plant   855 QVQSLTLSNCKNLRSLVKISDASQ--DPSLYSLLELCLDNCKNVKSL-----------SDQLSHF 906

  Fly   302 PELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLA 366
            |:|..|.||.:..::||..:..|..| |..|.||   |    .||..|:.|.||           
plant   907 PKLAYLDLSSHDFKKLPSSIRDLTSL-VTLCLNN---C----KKLKSLEELPLS----------- 952

  Fly   367 LVPSRNLKYLDLSGNLQLQVDE-QQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQN 430
                  |::||..|...|:.|: :.||                  .|..      |:||||    
plant   953 ------LQFLDAKGCDSLEADDLEHFK------------------GRVN------REVSAQ---- 983

  Fly   431 KTSGPWTMGFAET 443
                |.:..|.||
plant   984 ----PHSARFQET 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/22 (32%)
LRR_8 109..169 CDD:290566 14/107 (13%)
leucine-rich repeat 111..135 CDD:275380 6/39 (15%)
leucine-rich repeat 136..158 CDD:275380 6/51 (12%)
leucine-rich repeat 159..183 CDD:275380 6/26 (23%)
leucine-rich repeat 184..209 CDD:275380 5/24 (21%)
LRR_8 205..266 CDD:290566 20/70 (29%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 10/32 (31%)
LRR_RI <256..410 CDD:238064 36/158 (23%)
leucine-rich repeat 256..276 CDD:275380 6/23 (26%)
LRR_8 279..359 CDD:290566 21/79 (27%)
leucine-rich repeat 280..303 CDD:275380 1/22 (5%)
leucine-rich repeat 304..348 CDD:275380 15/43 (35%)
leucine-rich repeat 349..372 CDD:275380 4/22 (18%)
PP2Cc 461..655 CDD:294085
AT5G40100NP_198826.1 PLN03210 12..>943 CDD:215633 81/368 (22%)
leucine-rich repeat 790..812 CDD:275380 5/21 (24%)
leucine-rich repeat 813..835 CDD:275380 5/23 (22%)
leucine-rich repeat 856..884 CDD:275380 6/29 (21%)
leucine-rich repeat 885..908 CDD:275380 3/33 (9%)
leucine-rich repeat 909..931 CDD:275380 7/21 (33%)
leucine-rich repeat 953..972 CDD:275381 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.