DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G36930

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001119319.1 Gene:AT5G36930 / 833662 AraportID:AT5G36930 Length:1191 Species:Arabidopsis thaliana


Alignment Length:412 Identity:90/412 - (21%)
Similarity:156/412 - (37%) Gaps:116/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQTSPQKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIING 108
            |..:.:.||||...:                    :.:..::.:.|:::.|:....:.::|  ||
plant   526 GTNAIEGLSLKADVM--------------------DFQYFEVEAFAKMQELRLLELRYVDL--NG 568

  Fly   109 T-------------------------NLQTLVA---DHNYLHNISTTNTHPVPLKLQR-IDISHN 144
            :                         :|::|.|   .::.|.......:.|.|..:.: :|:||:
plant   569 SYEHFPKDLRWLCWHGFSLECFPINLSLESLAALDLQYSNLKRFWKAQSPPQPANMVKYLDLSHS 633

  Fly   145 -------NFSELPN----WVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYND---LK 195
                   :||..||    .:..|.||..::.|...|:...|||   .::..:.||:...:   ||
plant   634 VYLRETPDFSYFPNVEKLILINCKSLVLVHKSIGILDKKLVLL---NLSSCIELDVLPEEIYKLK 695

  Fly   196 QLDQ-FPEGFSSIRSLQLQSNELPSLPD---NFFAVTHARLETLNVSCNKLSTLPRYEQNNHAAL 256
            .|:. |....|.:..|.....||.||..   :|.|     |..:..:.|:|..|.|...|....|
plant   696 SLESLFLSNCSKLERLDDALGELESLTTLLADFTA-----LREIPSTINQLKKLKRLSLNGCKGL 755

  Fly   257 V-----NLSLAGNHLNDSIFEP--LHNAAKLRVLHLAYNRIG--VLPAACVRNWPELEILVLSGN 312
            :     ||....:| :.|:..|  |.....:|:|.|.|..:.  ::|.. :.:...|..|.|.||
plant   756 LSDDIDNLYSEKSH-SVSLLRPVSLSGLTYMRILSLGYCNLSDELIPED-IGSLSFLRDLDLRGN 818

  Fly   313 MLQQLPEEVAT---LGQLRVLRCCNNL--------------------LLCTPQLAKLAMLKVLDL 354
            ....||.:.||   ||:| :|..|:.|                    |..||.::|.:.|..|.|
plant   819 SFCNLPTDFATLPNLGEL-LLSDCSKLQSILSLPRSLLFLDVGKCIMLKRTPDISKCSALFKLQL 882

  Fly   355 SHNHLDRVNLLALVPSRNLKYL 376
            :    |.::|..:....|.:||
plant   883 N----DCISLFEIPGIHNHEYL 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/43 (9%)
LRR_8 109..169 CDD:290566 17/99 (17%)
leucine-rich repeat 111..135 CDD:275380 6/26 (23%)
leucine-rich repeat 136..158 CDD:275380 8/33 (24%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 7/28 (25%)
LRR_8 205..266 CDD:290566 17/68 (25%)
leucine-rich repeat 210..230 CDD:275380 7/22 (32%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 39/153 (25%)
leucine-rich repeat 256..276 CDD:275380 7/26 (27%)
LRR_8 279..359 CDD:290566 27/104 (26%)
leucine-rich repeat 280..303 CDD:275380 5/24 (21%)
leucine-rich repeat 304..348 CDD:275380 19/66 (29%)
leucine-rich repeat 349..372 CDD:275380 5/22 (23%)
PP2Cc 461..655 CDD:294085
AT5G36930NP_001119319.1 PLN03210 15..>890 CDD:215633 87/400 (22%)
TIR 17..180 CDD:279864
leucine-rich repeat 602..622 CDD:275380 2/19 (11%)
leucine-rich repeat 625..655 CDD:275380 7/29 (24%)
leucine-rich repeat 673..696 CDD:275380 6/25 (24%)
leucine-rich repeat 697..720 CDD:275380 6/22 (27%)
leucine-rich repeat 721..743 CDD:275380 6/26 (23%)
leucine-rich repeat 744..784 CDD:275380 10/40 (25%)
leucine-rich repeat 785..809 CDD:275380 5/24 (21%)
leucine-rich repeat 810..832 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.