DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G17680

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001331467.1 Gene:AT5G17680 / 831634 AraportID:AT5G17680 Length:1295 Species:Arabidopsis thaliana


Alignment Length:374 Identity:95/374 - (25%)
Similarity:158/374 - (42%) Gaps:82/374 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LEVCENEMEVLDLSSLAQLETLKCSR-NKLMELIINGTNLQTLVADHNYLHN------------- 123
            |..|:..:||.|||....||.|..|. ..|:|:..:..||:.|..  .||.|             
plant   633 LSRCKYLVEVPDLSKATNLEELNLSYCQSLVEVTPSIKNLKGLSC--FYLTNCIQLKDIPIGIIL 695

  Fly   124 ----------------------------ISTTNTHPVPLKLQR------IDISH-NNFSELPNWV 153
                                        :|:|....:|..:.|      :|:|. .....||:::
plant   696 KSLETVGMSGCSSLKHFPEISWNTRRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYL 760

  Fly   154 GACASLTAINASH-NRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNEL 217
            |...||.::|... .||.|:...|:|  :|.|.:|::  :....:::||...:||..|::....:
plant   761 GHLVSLKSLNLDGCRRLENLPDTLQN--LTSLETLEV--SGCLNVNEFPRVSTSIEVLRISETSI 821

  Fly   218 PSLPDNFFAVTHARLETLNVSCNK-LSTLPRYEQNNHAALVNLSLAGNHLNDSI-FEPLHNAAKL 280
            ..:|.....:  ::|.:|::|.|| |::|| ...:...:|..|.|:|..:.:|. .|.....:.|
plant   822 EEIPARICNL--SQLRSLDISENKRLASLP-VSISELRSLEKLKLSGCSVLESFPLEICQTMSCL 883

  Fly   281 RVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLL-------- 337
            |...|....|..||.. :.|...||:|..|..::::.|..:|.|.:|:||...|:..        
plant   884 RWFDLDRTSIKELPEN-IGNLVALEVLQASRTVIRRAPWSIARLTRLQVLAIGNSFFTPEGLLHS 947

  Fly   338 LCTPQLAKLAMLKVLDLSHNHLDRV-----NLLALVPSRNLKYLDLSGN 381
            || |.|::...|:.|.||:.::..:     ||.      ||..||||||
plant   948 LC-PPLSRFDDLRALSLSNMNMTEIPNSIGNLW------NLLELDLSGN 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/19 (32%)
LRR_8 109..169 CDD:290566 18/108 (17%)
leucine-rich repeat 111..135 CDD:275380 8/64 (13%)
leucine-rich repeat 136..158 CDD:275380 6/28 (21%)
leucine-rich repeat 159..183 CDD:275380 7/24 (29%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 16/61 (26%)
leucine-rich repeat 210..230 CDD:275380 2/19 (11%)
leucine-rich repeat 232..255 CDD:275380 8/23 (35%)
LRR_RI <256..410 CDD:238064 42/140 (30%)
leucine-rich repeat 256..276 CDD:275380 6/20 (30%)
LRR_8 279..359 CDD:290566 26/87 (30%)
leucine-rich repeat 280..303 CDD:275380 7/22 (32%)
leucine-rich repeat 304..348 CDD:275380 15/51 (29%)
leucine-rich repeat 349..372 CDD:275380 6/27 (22%)
PP2Cc 461..655 CDD:294085
AT5G17680NP_001331467.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.