DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT5G10020

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_196564.1 Gene:AT5G10020 / 830865 AraportID:AT5G10020 Length:1048 Species:Arabidopsis thaliana


Alignment Length:828 Identity:186/828 - (22%)
Similarity:313/828 - (37%) Gaps:224/828 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSLKGSQLGGSIL----IGNYNYLTQLEVCENEM--EVLDLSSLAQLETLKCSRNKL-----MEL 104
            |:|..:.|.|...    ||::..|..:::..|::  |:....|...|..||.:||:|     .||
plant   228 LNLSHNALNGKFFSEESIGSFKNLEIVDLENNQINGELPHFGSQPSLRILKLARNELFGLVPQEL 292

  Fly   105 IINGTNLQTLVADHN-YLHNISTTNTHPVPLKLQRIDISHNNFS-ELPNWVGACASLTAINASHN 167
            :.:...|..|....| :..:||..|:.    .|..:::|.|..| :||:...:|   :.|:.|.|
plant   293 LQSSIPLLELDLSRNGFTGSISEINSS----TLTMLNLSSNGLSGDLPSSFKSC---SVIDLSGN 350

  Fly   168 RLNNVAVLLRNYRITELVSLDLAYNDLK-QLDQFPEGFSSIRSLQLQSN----ELPSL-PDNFFA 226
            ..:....:::.:..|..| |||:.|:|. .|..|...||.:..|.:::|    .|||| .|:.|:
plant   351 TFSGDVSVVQKWEATPDV-LDLSSNNLSGSLPNFTSAFSRLSVLSIRNNSVSGSLPSLWGDSQFS 414

  Fly   227 VTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIG 291
            |       :::|.||.|..........|:|.:|:|:.|:|...|......|::|.||:       
plant   415 V-------IDLSSNKFSGFIPVSFFTFASLRSLNLSRNNLEGPIPFRGSRASELLVLN------- 465

  Fly   292 VLPAACVRNWPELEILVLSGNMLQ-QLPEEVATLGQLRVLRCCNNLLL--CTPQLAKLAMLKVLD 353
                    ::|::|:|.||.|.|. .||.::.|:.:::||...||.|.  ....|.||:.|..||
plant   466 --------SYPQMELLDLSTNSLTGMLPGDIGTMEKIKVLNLANNKLSGELPSDLNKLSGLLFLD 522

  Fly   354 LSHNHLDRVNLLALVPSR----NLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAA 414
            ||:|.. :..:...:||:    |:.|.||||            :.....:.:.......||::.:
plant   523 LSNNTF-KGQIPNKLPSQMVGFNVSYNDLSG------------IIPEDLRSYPPSSFYPGNSKLS 574

  Fly   415 LPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSV-YQLRAANYGGSDEALYGMF----- 473
            ||         .|....:||..::     ||.....|||: ..:..|:.|.:...|:.:|     
plant   575 LP---------GRIPADSSGDLSL-----PGKKHHSKLSIRIAIIVASVGAAIMILFVLFAYHRT 625

  Fly   474 --EALEGRGRAAQEMS--------HLVPDLMK-QEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAA 527
              :...||.|...:.:        ...|.|.. ...:.:.|:...:....||.|..:..|.....
plant   626 QLKDFHGRNRFTDQATTRDTKFGRSSRPSLFNFSSNVEQQSSSLSFSNDHLLTANSRSLSGIPGC 690

  Fly   528 LFHLTRTRAPSKVRPLKSKRYVL--------RMASTGG---------------LDAYLIRRTS-- 567
            ...::...||:...|..    :|        |.:|:||               ||.|...|.:  
plant   691 EAEISEQGAPATSAPTN----LLDDYPAASGRKSSSGGSPLSSSPRFSDQPVMLDVYSPDRLAGE 751

  Fly   568 ------QLRLT------KPDVIQKDQIH------SMPDPHVLELILSNDDEYLVVGNAQLWSVMD 614
                  .|:||      .|..:.....|      ::.:.|:|.:      ::|.||..:  ...|
plant   752 LFFLDVSLKLTAEELSRAPAEVLGRSSHGTLYKATLDNGHMLTV------KWLRVGLVR--HKKD 808

  Fly   615 IDRAAREI------------------RKEENSLLAAKRLVDIAQSFAAAESLSVIVVRFRHLGTD 661
            ..|.|::|                  |::|..||:         .:...|||::      ||...
plant   809 FAREAKKIGSLKHPNIVPLRAYYWGPREQERLLLS---------DYLRGESLAM------HLYET 858

  Fly   662 VDH------LIRELKQSV-----------RKKP----QPVSLPLSSGSVCKRTCCDRSNACRHRA 705
            ...      ..:.||.:|           |..|    :|.::.|||.....|.    ::.|.||.
plant   859 TPRRYSPMSFSQRLKVAVEVAQCLLYLHDRAMPHGNLKPTNIILSSPDNTVRI----TDYCVHRL 919

  Fly   706 IEQEPLA---------GRSSPSGQSDRDLLAKDKDDEFVLAHARVLQE 744
            :....:|         |.|:|...|....:...|.|  |.|...:|.|
plant   920 MTPSGVAEQILNMSALGYSAPELSSASKPIPTLKSD--VYAFGVILME 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/23 (35%)
LRR_8 109..169 CDD:290566 16/61 (26%)
leucine-rich repeat 111..135 CDD:275380 6/24 (25%)
leucine-rich repeat 136..158 CDD:275380 7/22 (32%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 10/25 (40%)
LRR_8 205..266 CDD:290566 19/65 (29%)
leucine-rich repeat 210..230 CDD:275380 9/24 (38%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 42/160 (26%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 27/82 (33%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 17/46 (37%)
leucine-rich repeat 349..372 CDD:275380 8/26 (31%)
PP2Cc 461..655 CDD:294085 46/270 (17%)
AT5G10020NP_196564.1 PLN00113 26..1047 CDD:215061 186/828 (22%)
leucine-rich repeat 80..100 CDD:275380
leucine-rich repeat 101..124 CDD:275380
leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 149..172 CDD:275380
leucine-rich repeat 173..196 CDD:275380
leucine-rich repeat 225..250 CDD:275380 6/21 (29%)
leucine-rich repeat 251..273 CDD:275380 4/21 (19%)
leucine-rich repeat 274..320 CDD:275380 14/49 (29%)
leucine-rich repeat 321..342 CDD:275380 6/20 (30%)
leucine-rich repeat 368..392 CDD:275380 10/24 (42%)
leucine-rich repeat 393..436 CDD:275380 13/49 (27%)
leucine-rich repeat 437..469 CDD:275380 10/46 (22%)
leucine-rich repeat 470..493 CDD:275380 9/22 (41%)
leucine-rich repeat 494..515 CDD:275380 6/20 (30%)
leucine-rich repeat 518..539 CDD:275380 7/21 (33%)
leucine-rich repeat 540..560 CDD:275380 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.