Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_193685.6 | Gene: | AT4G19500 / 827691 | AraportID: | AT4G19500 | Length: | 1309 | Species: | Arabidopsis thaliana |
Alignment Length: | 260 | Identity: | 68/260 - (26%) |
---|---|---|---|
Similarity: | 110/260 - (42%) | Gaps: | 60/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 CENEMEVLDLSSLAQLETLK--CSR--NKLMELIINGTNLQTLVADHNYLHNISTTNTHPV---- 132
Fly 133 ----PLKLQRIDISHNNFSELPNWVGA--CASLTAINASHNRLNNVAVLLRNYRITELVSLDLAY 191
Fly 192 NDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNV-SCNKLSTLPRYEQNNHAA 255
Fly 256 LVNLSLAGNHLNDSIFEPLHN-AAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSG-NMLQQLP 318
Fly 319 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 7/22 (32%) |
LRR_8 | 109..169 | CDD:290566 | 16/69 (23%) | ||
leucine-rich repeat | 111..135 | CDD:275380 | 7/31 (23%) | ||
leucine-rich repeat | 136..158 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 159..183 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 205..266 | CDD:290566 | 14/61 (23%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 2/19 (11%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 7/23 (30%) | ||
LRR_RI | <256..410 | CDD:238064 | 23/65 (35%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 7/19 (37%) | ||
LRR_8 | 279..359 | CDD:290566 | 15/41 (37%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 6/16 (38%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | |||
AT4G19500 | NP_193685.6 | LRR_3 | 1..>414 | CDD:332712 | |
DUF640 | 496..571 | CDD:309816 | |||
LRR_3 | 581..>1291 | CDD:332712 | 65/250 (26%) | ||
leucine-rich repeat | 1147..1169 | CDD:275381 | 5/23 (22%) | ||
leucine-rich repeat | 1170..1192 | CDD:275381 | 8/32 (25%) | ||
leucine-rich repeat | 1193..1216 | CDD:275381 | 7/36 (19%) | ||
leucine-rich repeat | 1261..1283 | CDD:275381 | 8/22 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X32 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |