DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RPP4

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_193420.2 Gene:RPP4 / 827395 AraportID:AT4G16860 Length:1147 Species:Arabidopsis thaliana


Alignment Length:412 Identity:103/412 - (25%)
Similarity:152/412 - (36%) Gaps:119/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCS-RN--KLMELIINGT---- 109
            |||...||.|   .|...:..|.:..| :|.|:||....|.||..| :|  ||..|..:|.    
plant   631 SLKKMDLGCS---NNLKEIPDLSLAIN-LEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLID 691

  Fly   110 --------NLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASH 166
                    ||:.|..|.:.:.  .|.....:|.||:|:            |...|.         
plant   692 LKSLEGMCNLEYLSVDWSSME--GTQGLIYLPRKLKRL------------WWDYCP--------- 733

  Fly   167 NRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQ-SNELPSLPDNFFAVTHA 230
                 |..|..|::...||.|.:..:||::|....:...|::.:.|. |..|..:||...|:...
plant   734 -----VKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLE 793

  Fly   231 RLETLNVSCNKLSTLPRYEQN----------------------NHAALVNLSLAG---------N 264
            ||...  .|..|.|||...||                      |..:|..|:|.|         .
plant   794 RLYLF--GCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAI 856

  Fly   265 HLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAA-----CVRNW------PE-LEILVLSGNMLQQL 317
            .:..|.||.|.:..::.|....:|:  .|||.     |:...      || |..|.:||...::|
plant   857 KMGCSYFEILQDRNEIEVEDCFWNK--NLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKL 919

  Fly   318 PEEVATLGQLRVLRCCNNLLLC-TPQLAKLAMLKVLDLSH--------------NHLDRVNL--- 364
            .|.:.:||.|:.:....:..|. .|.|:|...||.|.|:.              :.|.|:.:   
plant   920 WEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKEC 984

  Fly   365 --LALVPS----RNLKYLDLSG 380
              |.|:|:    .:|..|||||
plant   985 TGLELLPTDVNLSSLIILDLSG 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 9/33 (27%)
LRR_8 109..169 CDD:290566 11/71 (15%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
LRR_8 205..266 CDD:290566 21/92 (23%)
leucine-rich repeat 210..230 CDD:275380 6/20 (30%)
leucine-rich repeat 232..255 CDD:275380 9/44 (20%)
LRR_RI <256..410 CDD:238064 44/170 (26%)
leucine-rich repeat 256..276 CDD:275380 8/28 (29%)
LRR_8 279..359 CDD:290566 25/106 (24%)
leucine-rich repeat 280..303 CDD:275380 6/33 (18%)
leucine-rich repeat 304..348 CDD:275380 13/44 (30%)
leucine-rich repeat 349..372 CDD:275380 9/45 (20%)
PP2Cc 461..655 CDD:294085
RPP4NP_193420.2 PLN03210 13..>1081 CDD:215633 103/412 (25%)
TIR 13..175 CDD:279864
AAA_22 206..306 CDD:290137
LRR_3 608..626 CDD:285026
leucine-rich repeat 609..631 CDD:275380 103/412 (25%)
leucine-rich repeat 632..654 CDD:275380 7/24 (29%)
leucine-rich repeat 655..678 CDD:275380 9/22 (41%)
leucine-rich repeat 679..700 CDD:275380 3/20 (15%)
leucine-rich repeat 724..768 CDD:275380 13/69 (19%)
LRR_3 745..764 CDD:285026 6/18 (33%)
leucine-rich repeat 746..763 CDD:275380 6/16 (38%)
leucine-rich repeat 769..791 CDD:275380 6/21 (29%)
leucine-rich repeat 792..815 CDD:275380 9/24 (38%)
leucine-rich repeat 816..838 CDD:275380 1/21 (5%)
leucine-rich repeat 906..928 CDD:275380 7/21 (33%)
leucine-rich repeat 929..951 CDD:275380 5/21 (24%)
leucine-rich repeat 952..975 CDD:275380 4/22 (18%)
leucine-rich repeat 976..998 CDD:275380 5/21 (24%)
leucine-rich repeat 1021..1042 CDD:275380
leucine-rich repeat 1043..1066 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.