DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and WRKY19

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001118968.1 Gene:WRKY19 / 826810 AraportID:AT4G12020 Length:1895 Species:Arabidopsis thaliana


Alignment Length:403 Identity:86/403 - (21%)
Similarity:155/403 - (38%) Gaps:111/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGF----SSIRSLQLQSNELPS 219
            |..:|...:...||...:.|.|   |:.|..:..:.|....||:|.    |.:|.|..:...|.|
plant  1158 LDMLNLKFDANPNVFEKMCNLR---LLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSS 1219

  Fly   220 LPDNF-------------------------FAVTHARLETLNVS----CNKLSTLPRYEQNNHA- 254
            ||.:|                         |..|::.||.|...    .::|:.:||.....:. 
plant  1220 LPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLE 1284

  Fly   255 --------ALVNLSLAGNHLNDSIFEPLHNAAK------------LRVLHLA-YNRIGVLPAACV 298
                    :|::||.:.::|...:|..|...:|            |.||:|: .:::|..|... 
plant  1285 HIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEIS- 1348

  Fly   299 RNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHN-HLDRV 362
               |.::.|.:.|.|:|::|..:            .||:|          |:.|||.:: ||.  
plant  1349 ---PNVKELYMGGTMIQEIPSSI------------KNLVL----------LEKLDLENSRHLK-- 1386

  Fly   363 NL-LALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTT-------- 418
            || .::...::|:.|:|||.:.|    ::|. ..|:..:....:|:|..:...||::        
plant  1387 NLPTSIYKLKHLETLNLSGCISL----ERFP-DSSRRMKCLRFLDLSRTDIKELPSSISYLTALD 1446

  Fly   419 KIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRA- 482
            ::..|.::||....:.|........|  .:..||.:....|.|    :..:.|..|...|..|. 
plant  1447 ELLFVDSRRNSPVVTNPNANSTELMP--SESSKLEILGTPADN----EVVVGGTVEKTRGIERTP 1505

  Fly   483 ---AQEMSHLVPD 492
               .:...:|:||
plant  1506 TILVKSREYLIPD 1518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 2/9 (22%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 7/28 (25%)
LRR_8 205..266 CDD:290566 19/98 (19%)
leucine-rich repeat 210..230 CDD:275380 8/44 (18%)
leucine-rich repeat 232..255 CDD:275380 6/35 (17%)
LRR_RI <256..410 CDD:238064 40/168 (24%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 20/93 (22%)
leucine-rich repeat 280..303 CDD:275380 6/23 (26%)
leucine-rich repeat 304..348 CDD:275380 8/43 (19%)
leucine-rich repeat 349..372 CDD:275380 8/24 (33%)
PP2Cc 461..655 CDD:294085 8/36 (22%)
WRKY19NP_001118968.1 PAH 324..368 CDD:280780
WRKY 467..523 CDD:214815
WRKY 640..>661 CDD:214815
PLN03210 663..>1448 CDD:215633 70/325 (22%)
leucine-rich repeat 1260..1282 CDD:275380 4/21 (19%)
leucine-rich repeat 1283..1306 CDD:275380 4/22 (18%)
leucine-rich repeat 1307..1329 CDD:275380 3/21 (14%)
leucine-rich repeat 1330..1350 CDD:275380 6/23 (26%)
leucine-rich repeat 1351..1373 CDD:275380 7/33 (21%)
leucine-rich repeat 1398..1421 CDD:275380 8/27 (30%)
leucine-rich repeat 1422..1444 CDD:275380 4/21 (19%)
PKc_like 1626..1877 CDD:304357
S_TKc 1626..1877 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.