DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT4G08450

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_192585.1 Gene:AT4G08450 / 826403 AraportID:AT4G08450 Length:1234 Species:Arabidopsis thaliana


Alignment Length:382 Identity:99/382 - (25%)
Similarity:157/382 - (41%) Gaps:91/382 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLK---C-----------SRNKLME 103
            ||...|.||               ||..|..:||....||||.   |           :.|||..
plant   634 LKNMNLFGS---------------ENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTY 683

  Fly   104 LIINGT-NLQTLVADHN-------YLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLT 160
            |.::|. ||:...||.|       .|:..|.....|.        || :|.|||      |.:..
plant   684 LNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPA--------IS-SNISEL------CLNSL 733

  Fly   161 AIN--ASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQ-SNELPSLPD 222
            |:.  .|:..|.|:..||    |..:.|:.| ::.:|.|       :|::::.|: |..|..:||
plant   734 AVEEFPSNLHLENLVYLL----IWGMTSVKL-WDGVKVL-------TSLKTMHLRDSKNLKEIPD 786

  Fly   223 NFFAVTHARLETLNV-SCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLA 286
            ...|   :.|..||: .|..:..||...:|.| .|:.|.::| ..|...|....|...|:.::||
plant   787 LSMA---SNLLILNLEQCISIVELPSSIRNLH-NLIELDMSG-CTNLETFPTGINLQSLKRINLA 846

  Fly   287 -YNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLR--VLRCCNNLLLCTPQLAKLAM 348
             .:|:.:.|.... |..||:   ||...::::|..:....:|:  ::..||.|......::||..
plant   847 RCSRLKIFPDIST-NISELD---LSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKH 907

  Fly   349 LKVLDLSH-NHLDRVNLLAL-VPSRNLKYLDLSGNLQL---QVDEQQFKVCQSQSQR 400
            ||.:|.|. ..|.:.::..| ||:      :.|.:|.:   |..|..|..|...:|:
plant   908 LKSVDFSDCGILSKADMYMLQVPN------EASSSLPINCVQKAELIFINCYKLNQK 958

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 10/33 (30%)
LRR_8 109..169 CDD:290566 17/69 (25%)
leucine-rich repeat 111..135 CDD:275380 7/30 (23%)
leucine-rich repeat 136..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..183 CDD:275380 7/25 (28%)
leucine-rich repeat 184..209 CDD:275380 5/24 (21%)
LRR_8 205..266 CDD:290566 18/62 (29%)
leucine-rich repeat 210..230 CDD:275380 6/20 (30%)
leucine-rich repeat 232..255 CDD:275380 8/23 (35%)
LRR_RI <256..410 CDD:238064 38/153 (25%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 21/83 (25%)
leucine-rich repeat 280..303 CDD:275380 6/23 (26%)
leucine-rich repeat 304..348 CDD:275380 10/45 (22%)
leucine-rich repeat 349..372 CDD:275380 8/24 (33%)
PP2Cc 461..655 CDD:294085
AT4G08450NP_192585.1 PLN03210 2..1197 CDD:215633 99/382 (26%)
TIR 11..171 CDD:279864
AAA_16 203..324 CDD:289934
leucine-rich repeat 558..587 CDD:275380
leucine-rich repeat 589..619 CDD:275380
LRR_3 610..628 CDD:285026
leucine-rich repeat 657..680 CDD:275380 5/22 (23%)
leucine-rich repeat 681..703 CDD:275380 8/21 (38%)
leucine-rich repeat 704..724 CDD:275380 5/28 (18%)
leucine-rich repeat 725..746 CDD:275380 7/26 (27%)
leucine-rich repeat 747..769 CDD:275380 7/33 (21%)
leucine-rich repeat 770..792 CDD:275380 6/24 (25%)
leucine-rich repeat 793..816 CDD:275380 8/23 (35%)
leucine-rich repeat 817..839 CDD:275380 6/22 (27%)
leucine-rich repeat 863..883 CDD:275380 5/22 (23%)
leucine-rich repeat 884..907 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.