DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RLP45

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001325565.1 Gene:RLP45 / 824491 AraportID:AT3G53240 Length:927 Species:Arabidopsis thaliana


Alignment Length:467 Identity:119/467 - (25%)
Similarity:189/467 - (40%) Gaps:127/467 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSLKGSQLGGSI--LIGNYNYLTQLEVCENEME-VLDLSSLAQLETLK----CSRNKLMELI--- 105
            |.|..:.|.|.|  .|.::..:..|.:.:|:.| :..|..:.:|..||    .||:.:::::   
plant   243 LDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELKVFKLSSRSGMLQIVETN 307

  Fly   106 INGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLN 170
            ::| .||:                     :|..|.:||.|..::|.::.....|..|:.|:|.|:
plant   308 VSG-GLQS---------------------QLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILS 350

  Fly   171 NV--AVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLE 233
            .|  ..||.|.  |||.:|.|..|..|.|                     :||.     |..||:
plant   351 GVFPTWLLENN--TELQALLLQNNSFKTL---------------------TLPR-----TMRRLQ 387

  Fly   234 TLNVSCNKLST-LPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRI-GVLP-- 294
            .|::|.|..:. ||:......|:|.:|:|:.|....::...:.....:..:.|:||.. |.||  
plant   388 ILDLSVNNFNNQLPKDVGLILASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRN 452

  Fly   295 --AACVR-NWPELE-------------------ILVLSGNMLQ-QLPEEVATLGQLRVLRCCNNL 336
              ..|.. :|.:|.                   .|::..||.. ::|..:..|..|.|:...|||
plant   453 LFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNL 517

  Fly   337 LLCT-PQLAKLAMLKVLDLSHNHLDRVNLLALVPSR-NLKY---LDLSGN-----LQLQVDEQQF 391
            |..| |:......|:||.:|:|.|..    |:.||. |:.|   ||||||     |.|:      
plant   518 LTGTIPRWLGNFFLEVLRISNNRLQG----AIPPSLFNIPYLWLLDLSGNFLSGSLPLR------ 572

  Fly   392 KVCQSQSQRHWSLVDVSGNN-RAALPTT---KIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKL 452
                 .|..:..::|:..|| ..::|.|   .:|.:.. || ||.||...: |..||      .:
plant   573 -----SSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDL-RN-NKLSGNIPL-FRSTP------SI 623

  Fly   453 SVYQLRAANYGG 464
            ||..||..|..|
plant   624 SVVLLRENNLTG 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/25 (24%)
LRR_8 109..169 CDD:290566 12/59 (20%)
leucine-rich repeat 111..135 CDD:275380 2/23 (9%)
leucine-rich repeat 136..158 CDD:275380 6/21 (29%)
leucine-rich repeat 159..183 CDD:275380 9/25 (36%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 15/61 (25%)
leucine-rich repeat 210..230 CDD:275380 3/19 (16%)
leucine-rich repeat 232..255 CDD:275380 6/23 (26%)
LRR_RI <256..410 CDD:238064 47/189 (25%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 27/106 (25%)
leucine-rich repeat 280..303 CDD:275380 8/28 (29%)
leucine-rich repeat 304..348 CDD:275380 14/64 (22%)
leucine-rich repeat 349..372 CDD:275380 9/23 (39%)
PP2Cc 461..655 CDD:294085 2/4 (50%)
RLP45NP_001325565.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.