DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT3G44670

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001078237.1 Gene:AT3G44670 / 823593 AraportID:AT3G44670 Length:1219 Species:Arabidopsis thaliana


Alignment Length:384 Identity:102/384 - (26%)
Similarity:159/384 - (41%) Gaps:86/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LIGNYNYLTQLEVC---ENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNI 124
            |.|..:||...|..   .|:.|.:.:::|...|.|:.:   |.:||.:...:::| ..::| .||
plant   625 LFGTQDYLNISEKALERMNDFEFVRINALIPTERLQLA---LQDLICHSPKIRSL-KWYSY-QNI 684

  Fly   125 STTNTHPVPLKLQRIDISHNNFSELPN-WVGACASLTAINASHNRLNNVAVL-LRNYR-ITELVS 186
            ...:|......::    .|.:||:|.. |.|.           .:|.|:..: |.|.. :.||.:
plant   685 CLPSTFNPEFLVE----LHMSFSKLRKLWEGT-----------KQLRNLKWMDLSNSEDLKELPN 734

  Fly   187 LDLAYN-------DLKQLDQFPEGFSSIRSLQ---LQ-SNELPSLPDNFFAVTHARLETLNV-SC 239
            |..|.|       |...|.:.|.....:.|||   || .:.|..|| :|...|  :||.|.: :|
plant   735 LSTATNLEELKLRDCSSLVELPSSIEKLTSLQRLYLQRCSSLVELP-SFGNAT--KLEELYLENC 796

  Fly   240 NKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLA-YNRIGVLPAACVRNWPE 303
            :.|..||                          |..||..|:.|.|. .:|:..|||  :.|...
plant   797 SSLEKLP--------------------------PSINANNLQQLSLINCSRVVELPA--IENATN 833

  Fly   304 LEILVLSGN--MLQQLPEEVATLGQLRVLRC--CNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNL 364
            |:.|.| ||  .|.:||..:.|...|:.|..  |::|:.....:..:..||..|||:..    ||
plant   834 LQKLDL-GNCSSLIELPLSIGTATNLKELNISGCSSLVKLPSSIGDITNLKEFDLSNCS----NL 893

  Fly   365 LALVPSRNLKYLD---LSGNLQL----QVDEQQFKVCQSQSQRHWSLVDVSGNNRAALP 416
            :.|..:.|||:||   |:|..||    ::..:.|..|..:..|...|...:.||..:||
plant   894 VELPININLKFLDTLNLAGCSQLKSFPEISTKIFTDCYQRMSRLRDLRINNCNNLVSLP 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/18 (28%)
LRR_8 109..169 CDD:290566 11/60 (18%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 6/22 (27%)
leucine-rich repeat 159..183 CDD:275380 4/25 (16%)
leucine-rich repeat 184..209 CDD:275380 7/31 (23%)
LRR_8 205..266 CDD:290566 17/65 (26%)
leucine-rich repeat 210..230 CDD:275380 9/23 (39%)
leucine-rich repeat 232..255 CDD:275380 7/23 (30%)
LRR_RI <256..410 CDD:238064 45/165 (27%)
leucine-rich repeat 256..276 CDD:275380 1/19 (5%)
LRR_8 279..359 CDD:290566 26/84 (31%)
leucine-rich repeat 280..303 CDD:275380 8/23 (35%)
leucine-rich repeat 304..348 CDD:275380 13/47 (28%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085
AT3G44670NP_001078237.1 TIR 94..259 CDD:279864
AAA_16 268..392 CDD:289934
LRR_RI 657..888 CDD:238064 72/282 (26%)
leucine-rich repeat 673..692 CDD:275381 5/20 (25%)
leucine-rich repeat 695..717 CDD:275380 7/36 (19%)
leucine-rich repeat 718..740 CDD:275380 6/21 (29%)
leucine-rich repeat 741..764 CDD:275380 3/22 (14%)
leucine-rich repeat 765..787 CDD:275380 9/24 (38%)
leucine-rich repeat 788..810 CDD:275380 10/47 (21%)
AMN1 805..1003 CDD:187754 48/155 (31%)
leucine-rich repeat 811..833 CDD:275380 8/23 (35%)
leucine-rich repeat 834..857 CDD:275380 9/23 (39%)
leucine-rich repeat 858..881 CDD:275380 4/22 (18%)
leucine-rich repeat 882..904 CDD:275380 10/25 (40%)
leucine-rich repeat 937..968 CDD:275381 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.