DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT3G44630

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_850655.1 Gene:AT3G44630 / 823589 AraportID:AT3G44630 Length:1240 Species:Arabidopsis thaliana


Alignment Length:438 Identity:110/438 - (25%)
Similarity:187/438 - (42%) Gaps:93/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SPQKLSLKGSQLGGSILIGNYN--YLTQLEV-CE------------NEMEVLDLSSLAQLETLKC 96
            ||:..|||........|...:|  :|.:|:: |.            ..::.:|||....|:.|..
plant   693 SPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLRNLKWMDLSDSRDLKELPS 757

  Fly    97 SRNKLMEL-IINGTNLQTLV-----ADHNYLHNISTTNTHPVPLKLQRID-ISHNNFSELPNWVG 154
            |..||..| |::..:..:||     .:.|.|..:|.||...| :||..|: :::.:..:|.|   
plant   758 SIEKLTSLQILDLRDCSSLVKLPPSINANNLQGLSLTNCSRV-VKLPAIENVTNLHQLKLQN--- 818

  Fly   155 ACASLTAINASHNRLNNVAVL-LRNYRITELVSLDLAYNDLKQLDQFP--------EGFSSIRSL 210
             |:||..:..|....||:..| :|.  .:.||.|..:..|:..|.:|.        |..|||.:|
plant   819 -CSSLIELPLSIGTANNLWKLDIRG--CSSLVKLPSSIGDMTNLKEFDLSNCSNLVELPSSIGNL 880

  Fly   211 Q-------LQSNELPSLPDNFFAVTHARLETLNVS-CNKLSTLPRYEQNNHAALVNLSLAGNHLN 267
            |       ...::|.:||.|...::   |..|::: |::|.:.|  |.:.|  :..|.|.|..:.
plant   881 QKLFMLRMRGCSKLETLPTNINLIS---LRILDLTDCSQLKSFP--EISTH--ISELRLKGTAIK 938

  Fly   268 DSIFEPLH--NAAKLRVLHLAYNRIGVLPAACVRNWPE-LEI---LVLSGNMLQQLPEEVATLGQ 326
            :   .||.  :.::|.|..::|       ...::.:|. |:|   |:|....:|::|..|..:.:
plant   939 E---VPLSITSWSRLAVYEMSY-------FESLKEFPHALDIITDLLLVSEDIQEVPPWVKRMSR 993

  Fly   327 LRVLRCCN-NLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLS-GNLQLQVDEQ 389
            ||.||..| |.|:..|||.               |.::.:.....::|:.||.. .|.::::   
plant   994 LRALRLNNCNSLVSLPQLP---------------DSLDYIYADNCKSLERLDCCFNNPEIRL--- 1040

  Fly   390 QFKVCQSQSQRHWSLV-DVSGNNRAALPTTKIRQVSAQRNQNKTSGPW 436
            .|..|...:|....|: ..|....|.||:.   ||.|..|...|||.:
plant  1041 YFPKCFKLNQEARDLIMHTSTRKYAMLPSI---QVPACFNHRATSGDY 1085

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/19 (37%)
LRR_8 109..169 CDD:290566 17/65 (26%)
leucine-rich repeat 111..135 CDD:275380 8/28 (29%)
leucine-rich repeat 136..158 CDD:275380 5/22 (23%)
leucine-rich repeat 159..183 CDD:275380 6/24 (25%)
leucine-rich repeat 184..209 CDD:275380 10/32 (31%)
LRR_8 205..266 CDD:290566 19/68 (28%)
leucine-rich repeat 210..230 CDD:275380 6/26 (23%)
leucine-rich repeat 232..255 CDD:275380 7/23 (30%)
LRR_RI <256..410 CDD:238064 36/162 (22%)
leucine-rich repeat 256..276 CDD:275380 5/21 (24%)
LRR_8 279..359 CDD:290566 21/84 (25%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 17/47 (36%)
leucine-rich repeat 349..372 CDD:275380 1/22 (5%)
PP2Cc 461..655 CDD:294085
AT3G44630NP_850655.1 PLN03210 89..1107 CDD:215633 110/438 (25%)
TIR 94..259 CDD:279864
AAA 283..411 CDD:99707
LRR_3 717..736 CDD:285026 3/18 (17%)
leucine-rich repeat 741..764 CDD:275380 8/22 (36%)
leucine-rich repeat 765..787 CDD:275380 4/21 (19%)
leucine-rich repeat 788..810 CDD:275380 8/22 (36%)
AMN1 809..974 CDD:187754 44/187 (24%)
leucine-rich repeat 811..845 CDD:275380 10/39 (26%)
leucine-rich repeat 859..882 CDD:275380 7/22 (32%)
leucine-rich repeat 883..905 CDD:275380 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.