DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RLP32

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_187216.1 Gene:RLP32 / 819732 AraportID:AT3G05650 Length:868 Species:Arabidopsis thaliana


Alignment Length:646 Identity:132/646 - (20%)
Similarity:219/646 - (33%) Gaps:248/646 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AATFGQTSPQKLSLKGSQLGGSILIGNY---NYLTQLEVCEN--------------EMEVLDLS- 86
            ::.|...|...::|:.:||.|::..||.   :.||.|::..|              .::.|||| 
plant   256 SSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFIGPIPKSISKFINLQDLDLSH 320

  Fly    87 -------------SLAQLETLKCSR---------NKLMELIINGTNLQTLVADH-NYLHNISTTN 128
                         :|..|:.|..|.         |.|....:|......|..:| :....||..:
plant   321 LNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSSHLNSIYSMDLSGNHVSATTKISVAD 385

  Fly   129 THPVPL----------------------KLQRIDISHNNF-SELPNWVGACASLTAINASHNRL- 169
            .||..|                      |:..:|||:|.. .::|.|:.....|..::.|:|.. 
plant   386 HHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDISNNKIKGQVPGWLWTLPKLIFVDLSNNIFT 450

  Fly   170 -------------------------NNVAVLLRNY--RITELVSLDLAYNDLK------------ 195
                                     ||....:.::  .:..|::|||:.|:|.            
plant   451 GFERSTEHGLSLITKPSMQYLVGSNNNFTGKIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKS 515

  Fly   196 -----QLDQFPEG-------FSSIRSLQLQSNEL-PSLPDNFFAVTHARLETLNVSCNKLSTLPR 247
                 .|.|...|       |.|:|||.:..|:| ..||.:|..:  :.||.|||..|:::....
plant   516 TLSFLNLRQNRLGGGLPRSIFKSLRSLDVGHNQLVGKLPRSFIRL--SALEVLNVENNRINDTFP 578

  Fly   248 YEQNNHAALVNLSLAGNHLNDSIFEPLHNAA--KLRVLHLAYNRI-GVLPAACVRNWP------- 302
            :..::...|..|.|..|    :...|:|:|:  .||:::|::|:. |.|||....||.       
plant   579 FWLSSLKKLQVLVLRSN----AFHGPIHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMA 639

  Fly   303 ----------------------------ELEI---------LVLSGNMLQ-QLPEEVATLGQLRV 329
                                        |:|:         |..|.|.|: ::|..:..|.:|.|
plant   640 TEDRSQEKYMGDSFRYYHDSVVLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHV 704

  Fly   330 LRCCNNLLL--CTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSR--NLKYLDLSGNLQLQVDEQQ 390
            |...:|...  ....:..|..|:.||:|.|.|.     ..:|..  ||.||              
plant   705 LNLSSNAFTGHIPSSMGNLRELESLDVSQNKLS-----GEIPQELGNLSYL-------------- 750

  Fly   391 FKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVY 455
                        :.::.|.|....|    :...:..|.||.:|      |.:.||.         
plant   751 ------------AYMNFSHNQLGGL----VPGGTQFRRQNCSS------FKDNPGL--------- 784

  Fly   456 QLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAA 516
                  ||.|.|.:     .|:....|.|:  |..|:|.::::.|          |:.:||
plant   785 ------YGSSLEEV-----CLDIHAPAPQQ--HEPPELEEEDREV----------FSWIAA 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/27 (22%)
LRR_8 109..169 CDD:290566 17/83 (20%)
leucine-rich repeat 111..135 CDD:275380 7/46 (15%)
leucine-rich repeat 136..158 CDD:275380 6/22 (27%)
leucine-rich repeat 159..183 CDD:275380 5/51 (10%)
leucine-rich repeat 184..209 CDD:275380 11/48 (23%)
LRR_8 205..266 CDD:290566 19/61 (31%)
leucine-rich repeat 210..230 CDD:275380 6/20 (30%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 42/205 (20%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 28/127 (22%)
leucine-rich repeat 280..303 CDD:275380 10/58 (17%)
leucine-rich repeat 304..348 CDD:275380 12/55 (22%)
leucine-rich repeat 349..372 CDD:275380 7/24 (29%)
PP2Cc 461..655 CDD:294085 14/56 (25%)
RLP32NP_187216.1 LRRNT_2 42..86 CDD:311940
PLN00113 70..>787 CDD:331614 119/592 (20%)
leucine-rich repeat 121..144 CDD:275380
leucine-rich repeat 145..168 CDD:275380
leucine-rich repeat 169..191 CDD:275380
leucine-rich repeat 192..215 CDD:275380
leucine-rich repeat 216..263 CDD:275380 1/6 (17%)
leucine-rich repeat 264..288 CDD:275380 6/23 (26%)
leucine-rich repeat 289..312 CDD:275380 4/22 (18%)
leucine-rich repeat 313..337 CDD:275380 5/23 (22%)
leucine-rich repeat 367..390 CDD:275380 6/22 (27%)
leucine-rich repeat 391..414 CDD:275380 1/22 (5%)
leucine-rich repeat 415..438 CDD:275380 6/22 (27%)
leucine-rich repeat 439..467 CDD:275380 3/27 (11%)
leucine-rich repeat 468..491 CDD:275380 2/22 (9%)
leucine-rich repeat 492..515 CDD:275380 6/22 (27%)
leucine-rich repeat 517..538 CDD:275380 4/20 (20%)
leucine-rich repeat 539..562 CDD:275380 8/24 (33%)
leucine-rich repeat 563..586 CDD:275380 6/22 (27%)
leucine-rich repeat 609..636 CDD:275380 10/26 (38%)
leucine-rich repeat 637..701 CDD:275380 8/63 (13%)
leucine-rich repeat 702..725 CDD:275380 5/22 (23%)
leucine-rich repeat 726..749 CDD:275380 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.