DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and RLP28

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_180867.1 Gene:RLP28 / 817870 AraportID:AT2G33080 Length:740 Species:Arabidopsis thaliana


Alignment Length:492 Identity:106/492 - (21%)
Similarity:169/492 - (34%) Gaps:169/492 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIIN---GTNLQ 112
            |:|.|:...|||.:...:.|..|.:.....|...|..:::|..||  |.:|..|.|:   ..||.
plant   201 LNLYGNHFTGSIEVSTSSKLEILYLGLKPFEGQILEPISKLINLK--RLELSFLNISYPLDLNLF 263

  Fly   113 TLVADHNYLHNISTTNTHP--------VPL-----------------------KLQRIDISHNNF 146
            :.:....|| ::|..:..|        :||                       ||:.||:|:|..
plant   264 SSLKSLTYL-DLSGNSISPRSLRSDLYIPLTLEKLLLEQCGIIEFPNILKTLQKLEYIDMSNNRI 327

  Fly   147 S-ELPNWVGACASLTAINASHNRL----------------------NNVAVLLRNYRI------- 181
            : ::|.|:.....|.:::.::|..                      ||:...|.|..:       
plant   328 NGKIPEWLWRLPRLRSMSLANNSFNGFEGSTDVLVNSSMEILFMHSNNIQGALPNLPLSIKAFSA 392

  Fly   182 ----------------TELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELP-SLPDNFFAVTH 229
                            :.|.:|.|.||:.  ..:.|:..|::..:.|:.|.|. |:||...|  .
plant   393 GYNNFSGEIPLSICNRSSLAALSLPYNNF--TGKIPQCLSNLTFVHLRKNNLEGSIPDTLCA--G 453

  Fly   230 ARLETLNVSCNKLS-TLPRYEQNNHAALVNLSLAGNHLNDSI----------------------- 270
            ..|:||::..|.:| |||| ...|.::|..||:..|.:.|:.                       
plant   454 DSLQTLDIGFNLISGTLPR-SLLNCSSLEFLSVDNNRIKDTFPFWLKALPNLQVLILSSNKLYGP 517

  Fly   271 FEPLHNA----AKLRVLHLAYNRI-GVLPAACVRNWPELEILV---------------------- 308
            ..|.|.:    .:||:..:|.|.. |.|......||....:.|                      
plant   518 IAPPHQSPLAFPELRIFEIADNMFTGTLSPRYFVNWKTSSLTVNEDGDLYMVYKNNAFGIDSYVY 582

  Fly   309 --------------------------LSGNMLQ-QLPEEVATLGQLRVLRCCNNLLLC-TP-QLA 344
                                      .|||.|: |:|:.:..|.:|..|...||...| .| .||
plant   583 RDTIDMKYKGLSMEQQMVLNSYSAIDFSGNRLEGQIPKSIGLLKELIALNLSNNAFTCHIPLSLA 647

  Fly   345 KLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGN 381
            ....|:.||||.|.|.......|.....|.|:::|.|
plant   648 NATELESLDLSRNQLSGTIPNGLKTLSFLAYINVSHN 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/21 (33%)
LRR_8 109..169 CDD:290566 18/91 (20%)
leucine-rich repeat 111..135 CDD:275380 7/54 (13%)
leucine-rich repeat 136..158 CDD:275380 7/22 (32%)
leucine-rich repeat 159..183 CDD:275380 6/68 (9%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
LRR_8 205..266 CDD:290566 22/62 (35%)
leucine-rich repeat 210..230 CDD:275380 7/20 (35%)
leucine-rich repeat 232..255 CDD:275380 10/23 (43%)
LRR_RI <256..410 CDD:238064 43/205 (21%)
leucine-rich repeat 256..276 CDD:275380 6/42 (14%)
LRR_8 279..359 CDD:290566 30/131 (23%)
leucine-rich repeat 280..303 CDD:275380 8/23 (35%)
leucine-rich repeat 304..348 CDD:275380 16/94 (17%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085
RLP28NP_180867.1 LRR_8 101..161 CDD:290566
leucine-rich repeat 102..126 CDD:275380
LRR_RI <118..279 CDD:238064 22/80 (28%)
leucine-rich repeat 127..150 CDD:275380
LRR_8 149..208 CDD:290566 3/6 (50%)
leucine-rich repeat 151..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
leucine-rich repeat 198..243 CDD:275380 11/41 (27%)
leucine-rich repeat 244..268 CDD:275380 8/25 (32%)
leucine-rich repeat 269..292 CDD:275380 4/23 (17%)
LRR_8 293..351 CDD:290566 10/57 (18%)
leucine-rich repeat 294..316 CDD:275380 0/21 (0%)
leucine-rich repeat 317..340 CDD:275380 7/22 (32%)
LRR_RI <332..514 CDD:238064 37/186 (20%)
leucine-rich repeat 432..455 CDD:275380 7/24 (29%)
LRR_8 455..514 CDD:290566 15/59 (25%)
leucine-rich repeat 456..479 CDD:275380 10/23 (43%)
leucine-rich repeat 480..501 CDD:275380 5/20 (25%)
leucine-rich repeat 531..603 CDD:275380 9/71 (13%)
leucine-rich repeat 604..627 CDD:275380 7/22 (32%)
leucine-rich repeat 628..651 CDD:275380 8/22 (36%)
leucine-rich repeat 652..675 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.